KEGG   Methanoculleus sp. MAB1: MMAB1_2622Help
Entry
MMAB1_2622        CDS       T04314                                 

Definition
(GenBank) Dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit homolog (fragment)
  KO
K00528  ferredoxin/flavodoxin---NADP+ reductase [EC:1.18.1.2 1.19.1.1]
Organism
mema  Methanoculleus sp. MAB1
Pathway
mema01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mema00001]
 09100 Metabolism
  09112 Not included in regular maps
   09113 Global maps only
    MMAB1_2622
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MMAB1_2622
Enzymes [BR:mema01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.2  ferredoxin---NADP+ reductase
     MMAB1_2622
  1.19  Acting on reduced flavodoxin as donor
   1.19.1  With NAD+ or NADP+ as acceptor
    1.19.1.1  flavodoxin---NADP+ reductase
     MMAB1_2622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0669
Motif
Other DBs
NCBI-ProteinID: CVK33835
UniProt: A0A0X3BQQ5
Position
chrI:complement(2107576..2108256)
Genome map
AA seq 226 aa AA seqDB search
MKRLYKVELATKLADRVYEYWIHAPQVAHHARAGQFLILRLHETGERIPLTISAVRGDAV
RVIFMAVGKTTQELATLRAGDSIKDVAGPLGKPSEIGKYGTCCVIGGGVGIASTPLIAKE
LKEAGNHVIGIIGARSADLLILEDEMRAICDELYITTDDGSKGVHGFASDVLKGLLNERT
INRVWIIGPAIMMKVTSGVTVPYGVKTYVSSIRLWSTGPGCADPAG
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcggttgtacaaggtggaattggcgaccaaactcgccgaccgggtttacgaatac
tggatacacgcgccgcaggtggcgcaccatgcacgggcaggccagtttctcatcctgcgc
ctgcatgagacaggcgagcggataccgctcaccatctccgcagtcaggggagatgctgtc
cgggtaatatttatggccgtcggcaagacgacccaggaacttgcgacgctccgtgcgggg
gacagcatcaaggacgtcgcaggaccgctcggaaagccgagcgagatcgggaagtacgga
acctgctgcgtcatcggcggcggtgtcgggatcgcaagcacgccgctcatcgcaaaggaa
ctaaaagaggcaggcaaccacgtcatcgggatcatcggggcgcggagcgccgatctcctc
atcctggaggacgagatgcgcgcgatatgcgatgaactctatatcacgaccgacgacggg
agcaagggtgttcatgggtttgcaagcgacgtcctcaaaggtctgctgaacgagcggacg
atcaaccgggtctggatcatcggccctgccatcatgatgaaggtcacctccggcgtgacg
gtcccctacggcgtgaagacctacgtgagctcaatccgattatggtcgacgggaccggga
tgtgcggatcctgccgggtga

DBGET integrated database retrieval system