KEGG   Candidatus Moranella endobia PCIT: MEPCIT_445Help
Entry
MEPCIT_445        CDS       T01562                                 

Gene name
holC
Definition
(GenBank) putative DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
men  Candidatus Moranella endobia PCIT
Pathway
men00230  Purine metabolism
men00240  Pyrimidine metabolism
men01100  Metabolic pathways
men03030  DNA replication
men03430  Mismatch repair
men03440  Homologous recombination
Module
men_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:men00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MEPCIT_445 (holC)
   00240 Pyrimidine metabolism
    MEPCIT_445 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    MEPCIT_445 (holC)
   03430 Mismatch repair
    MEPCIT_445 (holC)
   03440 Homologous recombination
    MEPCIT_445 (holC)
Enzymes [BR:men01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     MEPCIT_445 (holC)
DNA replication proteins [BR:men03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     MEPCIT_445 (holC)
DNA repair and recombination proteins [BR:men03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     MEPCIT_445 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: AEI75063
UniProt: F7XY87
Position
511138..511581
Genome map
AA seq 147 aa AA seqDB search
MKNATFYLLNQASLNLMEWLACYFTVDKWREGKLVLIACEDEAQALRIDEALWACDPDTF
VPHNLTGECSPYGTPVEICWQQRRGSNMNREVLISLLLSVYADFASSFNEVIDFVPAEAT
LKQLARNRYKTYRSVGFQLTTAIPPTR
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcaaccttttatttactcaaccaagccagtcttaacctcatggaatggctg
gcctgttattttaccgtcgataaatggcgggagggcaaactggtacttatcgcctgtgag
gatgaagcccaagcgcttagaatagacgaagcgctgtgggcgtgcgatcctgatactttc
gtaccacataacctgacgggagaatgctcgccatacggcacgccagtagaaatttgctgg
caacagcgccgtggtagtaacatgaatagggaggtgttgataagcttgctgttgtcggtc
tacgcggattttgcctcatcgtttaatgaagtcattgatttcgttccggctgaagcaact
ttaaaacagctggcgcgcaatcgttataaaacttatcgtagcgttggcttccaattgact
acggcaataccaccaacaaggtga

DBGET integrated database retrieval system