KEGG   Candidatus Moranella endobia PCVAL: MPC_232Help
Entry
MPC_232           CDS       T02613                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
meo  Candidatus Moranella endobia PCVAL
Pathway
meo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:meo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MPC_232 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:meo03011]
    MPC_232 (rplV)
Ribosome [BR:meo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    MPC_232 (rplV)
  Bacteria
    MPC_232 (rplV)
  Archaea
    MPC_232 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AGJ61268
Position
270678..271010
Genome map
AA seq 110 aa AA seqDB search
METIAQQRHACSSAQKVRLVADLIRGKKVSQALEILTYTNKKAAGLVRKVVESATANAEH
NDGADIDDLKIAKIFIDAGTNMKRIMPRAKGRADRILKRTSHITVVVSDS
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactattgctcaacagcgccacgcttgttcttctgctcaaaaagttcgcctggtt
gctgaccttattcgtggtaaaaaagtgtcgcaagctttagaaattctcacctataccaac
aagaaagcggcaggtttagtgaggaaagtagttgagtctgctactgctaatgctgaacac
aacgatggcgcagatatagatgatttgaaaatagctaagattttcatcgatgcaggcacg
aacatgaagcgcattatgccacgtgctaagggtcgtgccgaccgtatcctgaagcgtacc
agccatattactgtggttgtttctgatagctga

DBGET integrated database retrieval system