KEGG   Methylovorus sp. MP688: MPQ_0325Help
Entry
MPQ_0325          CDS       T01361                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
mep  Methylovorus sp. MP688
Pathway
mep03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mep00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MPQ_0325 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mep03011]
    MPQ_0325 (rplV)
Ribosome [BR:mep03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    MPQ_0325 (rplV)
  Bacteria
    MPQ_0325 (rplV)
  Archaea
    MPQ_0325 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF5610
Motif
Other DBs
NCBI-ProteinID: ADQ83508
Position
324240..324515
Genome map
AA seq 91 aa AA seqDB search
MVADLIRGKKVDYALNILNFTPKKGAEIIKKVVESAIANAEHNEGADIDELKVTSIYVDK
GIVLKRIRARAKGRAGRIIKPTCHITVTVGN
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
ttggttgctgacctgattcgcggcaagaaagttgattacgcactcaatattctgaatttc
acacctaaaaagggtgctgagatcatcaagaaggttgttgagtccgctatcgctaacgct
gaacacaacgaaggtgccgatatcgatgagttgaaggtcacttcaatctacgttgacaag
ggcatcgttcttaaacgtattcgtgcgcgtgccaaaggtcgtgctggacggattattaag
cctacatgtcacatcacagtgactgttggtaattaa

DBGET integrated database retrieval system