KEGG   Methylovorus sp. MP688: MPQ_0911Help
Entry
MPQ_0911          CDS       T01361                                 

Definition
(GenBank) aminotransferase class I and II
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mep  Methylovorus sp. MP688
Pathway
mep00220  Arginine biosynthesis
mep00250  Alanine, aspartate and glutamate metabolism
mep00290  Valine, leucine and isoleucine biosynthesis
mep01100  Metabolic pathways
mep01110  Biosynthesis of secondary metabolites
mep01130  Biosynthesis of antibiotics
mep01210  2-Oxocarboxylic acid metabolism
mep01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mep00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MPQ_0911
   00290 Valine, leucine and isoleucine biosynthesis
    MPQ_0911
   00220 Arginine biosynthesis
    MPQ_0911
Enzymes [BR:mep01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     MPQ_0911
    2.6.1.66  valine---pyruvate transaminase
     MPQ_0911
Amino acid related enzymes [BR:mep01007]
 Aminotransferase (transaminase)
  Class I
   MPQ_0911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ADQ84080
Position
907937..909178
Genome map
AA seq 413 aa AA seqDB search
MDPLLKSSKLNNVCYDIRGPVLARAREMEEDGHRIIKLNIGNPAPFGFEAPEEILQDVIH
NMDQASGYTDSKGLFAARKAIMHYTQQKNIAGVTIDDIIIGNGVSELIVMAMQALLNNGD
QVLVPMPDYPLWTAAVTLAGGTARHYLCDENTGWLPDLKDIESKITANTRGIVIINPNNP
TGALYPRETLEGIIEIARHHGLVIFADEIYDKVLYDGNTHTSIASLADDVLFVTFNGLSK
NYRTCGYRAGWLVVSGEKRHAGDYIEGLNMLASMRLCANVPGQLAIQTALGGYQSINDLV
APGGRLCKQRDLAYELLTAIPGVTCEKPAAAMYLFPRLDPKIYPIKDDQQFILDLLLEEK
VLLVQGSGFNWKKPDHFRVVFLPNVDDLTEAIKRIARFLEGYRKKHGTDKISA
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtggatccattactcaagtcttccaaactcaataacgtgtgctacgacattcgcggcccg
gtattggcgcgcgcgcgcgaaatggaagaagacggccaccgcatcatcaaactgaatatc
ggcaacccggcgccgtttggttttgaagcacccgaagagattctgcaggacgtgatccac
aatatggatcaggcgtccggttacaccgactccaagggcctgtttgccgcccgcaaagcc
atcatgcactacacccagcagaagaatattgcgggtgtgaccatcgatgacatcatcatc
ggcaatggcgtgtccgagctcatcgtcatggcaatgcaggcactgcttaataatggcgac
caggtgctggtgcccatgcccgactatccattgtggacagcggctgtcaccctggctggt
ggtactgcccgccactacctgtgcgatgaaaacaccggctggttgcctgatctcaaggac
attgagtccaagatcaccgctaacacgcgcggcattgtcatcatcaacccgaacaacccg
accggtgcgctttatccgcgtgaaacgctggaaggcattatcgaaatcgcccgccatcac
ggcctggtgatttttgctgacgagatttacgacaaggtgctgtatgacggcaacacgcac
acctccatcgcctcactggccgatgatgtgctgtttgtgaccttcaacggcttgtccaag
aattaccgtacctgcggctaccgtgctggctggctggtggtgtccggtgaaaaacggcat
gctggtgattatattgaaggcttgaacatgctggcctccatgcgcctctgtgccaacgtg
ccgggacaattggccatccagaccgcgctgggcggctatcagagcatcaatgatctggtg
gccccgggcggacgcctttgcaagcagcgtgacctcgcgtatgagttgctgacggcgatt
cccggtgtcacctgtgaaaagccagcggcggccatgtacctgttcccgcggctggacccc
aagatttacccgatcaaggatgaccagcagttcattcttgacctgttgctggaagaaaaa
gtcctgctggtgcagggcagtgggttcaactggaaaaaaccggatcatttccgcgtggtg
ttcctgcccaatgtggatgacctgaccgaagcgatcaagcgtattgcccgcttcctcgaa
ggctatcgcaagaagcacggcacagacaaaatcagcgcataa

DBGET integrated database retrieval system