KEGG   Methylovorus sp. MP688: MPQ_1234
Entry
MPQ_1234          CDS       T01361                                 

Definition
(GenBank) PaaR repeat-containing protein
Organism
mep  Methylovorus sp. MP688
SSDB
Motif
Pfam: PAAR_motif Phage_lysozyme Transglycosylas
Other DBs
NCBI-ProteinID: ADQ84398
Position
1245550..1246419
AA seq 289 aa
MGDTVMSRRFIVVGDPTDHDGKVISGSPTHTISGKPVARLGDKVDCPKKYPDGSPHGVNA
IVEGEPNCLIDGVPAALEGHKSECGCRLLATVSAFYGGEGGTLDSKIMNVKKEKISSSTL
KANRLNEDKESLKDPNVKAFLDAISEAEGGDYYFKYGAIKGKVNDKWRFTDDSTHPGAGF
DGKTTAAGRYQINYATWEDMGGRVGLSNFSPETQDVIAVEILRSIKVIDSIKKGDLDTAL
SAASKRWSALPQGKNLPGRFKGQPYMSYENFSEIFNQRVDFYKKNNTRE
NT seq 870 nt   +upstreamnt  +downstreamnt
gtgggggatacggtaatgtcgcgcaggtttattgtggtgggggatccaacagatcatgat
ggcaaggtgatcagtggctcgccaacgcacaccatctccggaaaaccggtggcaaggcta
ggggataaagtggattgccctaaaaaatatcccgatgggtctcctcacggcgttaatgct
attgtcgaaggggagccgaactgtttgattgatggggtcccggcggcactggagggccat
aagtcagaatgcggatgtcgtcttctggctaccgtcagtgctttctatggaggtgaaggt
ggcactcttgattcaaaaattatgaatgtaaaaaaagagaaaatttcctcatccacatta
aaagccaataggttaaacgaagacaaagagtcattgaaagatcctaatgtcaaagcgttt
cttgacgcaatttccgaagccgaaggtggggattattattttaaatatggcgcaataaaa
ggtaaggtgaatgataaatggaggttcacagatgactcaactcatccaggagctggattt
gatggaaaaaccacagcagcagggcgttatcagattaactatgcaacatgggaagatatg
ggtggtagagttggcttgagtaatttttccccggagacccaagatgttattgctgtcgag
attcttcgatcaataaaagtgatagactcgataaaaaaaggtgatttggacactgcatta
tcagctgcttctaaacgatggtctgctttgccacaaggaaaaaatttacctggaagattt
aaaggacaaccttacatgtcctatgagaatttttctgaaatatttaaccaaagagtggat
ttttataaaaaaaacaatacaagagagtaa

DBGET integrated database retrieval system