KEGG   Methanosarcina sp. WWM596: MSWHS_0872Help
Entry
MSWHS_0872        CDS       T03852                                 

Definition
(GenBank) Mannose-1-phosphate guanylyltransferase (GDP)
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
meq  Methanosarcina sp. WWM596
Pathway
meq00051  Fructose and mannose metabolism
meq00520  Amino sugar and nucleotide sugar metabolism
meq01100  Metabolic pathways
meq01110  Biosynthesis of secondary metabolites
meq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:meq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MSWHS_0872
   00520 Amino sugar and nucleotide sugar metabolism
    MSWHS_0872
Enzymes [BR:meq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     MSWHS_0872
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     MSWHS_0872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 AraC_binding Cupin_3 Cupin_6
Motif
Other DBs
NCBI-ProteinID: AKB17735
UniProt: A0A0E3NJQ1
Position
1034880..1036187
Genome map
AA seq 435 aa AA seqDB search
MYPKQFLKFGETSLFQETVLRCFEVSDISEIFVVTNEAQKFFVIGQIKEMGYSIPPENVL
IEPEGKNTLPAIFFGMKEIDRKFGNSIVGVFSSDHVLDRAAMATISSAEKLASDYLVTFG
VIPTLPHTGYGYIKASESCEPGYKVSEFREKPDFETAQIYIEEGCLWNSGMFLFETQLFF
EEVKKHAPSVFACFEKGGSINDIYACVDKVSIDYGIMEKSDRVAVVKLDQKWSDLGNFAA
IYDELEKDSVGNVIHECDSMLLNSDGNLVYSKCGKIVSLIDIKDMVIVDTSDALLICPKS
SSQKVKEIVTDLKGRNDERAFIGQTVYRPWGSYTLLDASPGHKIKNITVLSDHKLSLQLH
YHRSEHWVVVKGMACVEVDGDQFFLRPGESTFIRAGQKHRLSNPGKVPLEIIEVQLGELV
DEGDIVRFDDVYGRS
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtatcccaaacaatttttaaaattcggtgagacctcactttttcaggaaacagtgctt
cgatgttttgaggtttcagatatttctgagatttttgtggtaacgaacgaagcccagaaa
tttttcgtgatcggacagatcaaggaaatgggatactcaattcctcctgagaatgtcctg
atcgagcccgaaggcaagaacacacttcctgcaatcttctttggaatgaaagagattgat
agaaaattcgggaattcaatcgtaggggtattttcctccgatcatgtgcttgacagagct
gcaatggcaacgatttcttcagctgaaaagctggcttcggattatctggtcactttcggg
gttattcctacactccctcatacaggatacggttacattaaagcttcagagtcctgcgag
cctggttacaaggtttcggaattccgagaaaagcctgattttgaaaccgcacaaatatac
attgaagaaggctgtctctggaatagcgggatgttcctttttgagacgcagcttttcttt
gaagaagtcaaaaaacacgcgccttcggtttttgcctgctttgagaaagggggcagtatt
aatgacatttatgcatgtgtggataaggtttccattgattacggcataatggaaaagtct
gatagagttgctgtcgtaaagctggaccagaaatggagtgaccttggaaactttgcggca
atttatgacgagctggaaaaggattcagtaggaaacgtgatccatgaatgtgactccatg
cttctcaactcagacggcaacctagtgtattcgaaatgtggcaaaatcgtttccctgatt
gatattaaggatatggttattgttgacacgagtgatgctctgttaatatgtcccaaatcc
agcagccagaaagtaaaggaaatagtcaccgacctgaagggcaggaacgatgaaagagca
tttatcgggcaaacagtctaccgcccctggggttcatatacactccttgatgcttctccc
ggtcataaaataaaaaatattactgtgctttctgatcataagttaagcctgcaattgcac
taccacaggagtgaacactgggtggttgtaaaaggcatggcctgcgtggaagtggatgga
gatcagtttttcctgaggcctggggaaagcacatttatcagagccggacaaaagcacagg
ttatcgaatccggggaaggttccgctggagattattgaggtacagttaggagagcttgtg
gacgaaggggacattgtcaggtttgatgatgtttatgggagaagctga

DBGET integrated database retrieval system