KEGG   Chelativorans sp. BNC1: Meso_0262
Entry
Meso_0262         CDS       T00374                                 
Name
(GenBank) transcriptional regulator, LacI family
  KO
K05499  LacI family transcriptional regulator, repressor for deo operon, udp, cdd, tsx, nupC, and nupG
Organism
mes  Chelativorans sp. BNC1
Brite
KEGG Orthology (KO) [BR:mes00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mes03000]
    Meso_0262
Transcription factors [BR:mes03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    Meso_0262
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 Peripla_BP_4 LacI HTH_23 HTH_24 HTH_38 HTH_Crp_2 MarR_2 HTH_AsnC-type HTH_IclR Sigma70_r4_2 HTH_5 HTH_10 HTH_Tnp_ISL3 HTH_28 GerE HTH_29 HTH_AraC MarR Fe_dep_repress
Other DBs
NCBI-ProteinID: ABG61666
UniProt: Q11LQ9
Position
complement(302402..303436)
AA seq 344 aa
MSRARIKDIAAELGLSPATVSRALSHSPLVAEPTRSRVREAALRLNYRPNVSARNLRTQR
SMAVLMVVRDIGNPFYLDIVKGVEAAAREAGYVVLMGNTENNPEREIEYFDMLRDGHADG
MILITGKLPGGESLFQQLKDLPVVVALEPIEKSGFPHVMIDNTGAASEAVKHLISLGHRR
IAHIAGPVPEPMATRRREGYRQAIKAAGLELRPEYEGIGDYLLSSGERICRQFFSLPEPP
SAIFAANDEMAFGAINELRRMALCVPNDVSVVGFDDIFLSQAFYPPLTTVSQPRAAIGRE
AMRLLLEVMHGEGHTGETIMMPTTFQTRASTAPARSRRPHRRSA
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgagccgagcccgcatcaaggatatcgcagcggaactcggcctttcgccagccacggtc
tcccgcgccctgagccattcgccgctggtggcggagcccacacgcagccgcgtgcgggag
gcggcgctgcgcctcaactaccggcccaatgtgagcgcacgcaacttgcgcacccagcgc
tccatggccgtgctgatggtggtgcgcgacatcggcaaccccttctatctcgacatcgtc
aagggagtggaggccgctgcccgcgaggccggatatgtcgtgctgatgggcaatacggaa
aacaaccccgaacgcgagatcgaatatttcgacatgctgcgcgatggtcacgccgacggc
atgattctgatcacgggcaagctgccgggaggagaaagcctctttcagcaattgaaggat
ctgccggtggtcgtcgcgctggagcccatagagaaaagcgggtttccacatgtgatgatc
gataatacgggtgccgcgagcgaagcggtgaagcatctcatctcactcggccacaggcgc
atcgcgcatattgccggcccggttcccgagcccatggcaacgcgtcgccgagagggctac
cggcaagcgataaaggcagcggggctggagctgaggccggaatatgagggtatcggcgat
tacctgctttcctcgggcgaacggatctgccggcagttcttttcgctccccgagccgccc
agcgccattttcgcggcaaatgacgagatggccttcggcgccatcaatgaattgaggcgt
atggccctttgcgtgccgaatgacgtttccgtcgtcggcttcgacgacattttcctgagc
caggccttttatccgccgctcacgacggtgagccagccgcgcgcggcgatcggccgcgag
gccatgcgcctgctgctcgaagtgatgcatggcgaaggtcacaccggagagacaatcatg
atgccgacgacatttcagacacgggcttccacagcgccggcacgcagccgcaggcctcac
cgaagatcagcatga

DBGET integrated database retrieval system