KEGG   Chelativorans sp. BNC1: Meso_1763
Entry
Meso_1763         CDS       T00374                                 
Name
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mes  Chelativorans sp. BNC1
Pathway
mes00230  Purine metabolism
mes01100  Metabolic pathways
mes01232  Nucleotide metabolism
Module
mes_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mes00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Meso_1763
Enzymes [BR:mes01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Meso_1763
SSDB
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 AAA_22 AAA_33 ABC_tran AAA_29 cobW RsgA_GTPase
Other DBs
NCBI-ProteinID: ABG63157
UniProt: Q11HG8
Position
complement(1885199..1885855)
AA seq 218 aa
MESASPSATIRRRGVMLVLSSPSGAGKSTIARSLLENDHEFELSVSVTTRPRRPSEIEGV
HYHFKTQRDFEMMRDGGDLLEWAEVHGNCYGTPRGPVERAIAGGRDMLFDIDWQGAAQLR
EKMPDDIVSVFILPPTMKELLARLTRRAEDTPEIIERRLRNAHHEIEQWRDYDYVVINDD
LDRAFASVRAIVSAERLRHERRPGLEDFVAGLLAERPE
NT seq 657 nt   +upstreamnt  +downstreamnt
atggaatccgcctcgccatccgccacgatccgccgcaggggagtgatgctggttctctcc
tcgccttcgggtgccggcaaatcgaccattgcaaggagtctgctcgagaacgatcacgaa
ttcgagctgtcggtgagtgtcaccacgcgcccgcgccgccccagcgagatcgagggtgtg
cattatcatttcaagacgcagcgcgattttgagatgatgcgtgatggcggcgatctgctc
gaatgggccgaggtgcatggcaactgctacggcacgccccgcggcccagtcgaacgggcg
atcgcgggtggacgcgacatgctcttcgacatcgactggcagggggccgcgcagttgcgc
gaaaagatgccggacgatatcgtctccgtcttcatcctgccgccgaccatgaaggaattg
ctggcgcgcctcacaaggcgggcggaggatacgcccgagatcattgagcggcgcctaagg
aacgcccatcacgagatcgagcagtggcgagactacgattatgtcgtcataaacgacgat
ctggaccgcgcctttgcatccgtccgcgcgatcgtgtcggcggagcgtctacggcacgag
cggcggccgggacttgaggatttcgtggcggggcttttggcggagagaccggaatag

DBGET integrated database retrieval system