KEGG   Chelativorans sp. BNC1: Meso_0008Help
Entry
Meso_0008         CDS       T00374                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
mes  Chelativorans sp. BNC1
Pathway
mes00220  Arginine biosynthesis
mes01100  Metabolic pathways
mes01110  Biosynthesis of secondary metabolites
mes01130  Biosynthesis of antibiotics
mes01230  Biosynthesis of amino acids
Module
mes_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:mes00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Meso_0008
Enzymes [BR:mes01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     Meso_0008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N TOC159_MAD
Motif
Other DBs
NCBI-ProteinID: ABG61413
UniProt: Q11MG2
Position
complement(7199..8107)
Genome map
AA seq 302 aa AA seqDB search
MARNFIDLSAVSAADLRSILDDAKERKALLKSGKAGKPFEGKVLAMIFDKPSTRTRVSFD
VAMRQLGGDTIMLTGMEMQLGRSETIADTAKVLSRYVDAIMIRTTAHERLLELAENATVP
VINGLTDDTHPCQIMADIMTFEEHRGDVKDRLFAWSGDGNNVLHSLLEASARFGFRLNIA
TPVGSEPSAHYVEWAKTNGGRVTLTSDPEAAVRGADCVVTDTWISMGQEHRARGHNVFQP
YQVNERLMSFAKKEALFMHCLPAHRGEEVTDGVIDGPHSVVFDEAENRLHAQKAVLAWCL
GQ
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
ttggcacgcaatttcatcgatctttccgccgtttctgccgccgatctgcggtccattctg
gacgatgccaaggagcgcaaggcgctgctgaaatcagggaaggccggcaagcccttcgaa
ggcaaagtgcttgcgatgatcttcgacaagccttcgacccgcacgcgcgtttcgtttgat
gtggcgatgcgccagctcggcggcgatacgatcatgcttaccggcatggaaatgcagctc
ggtcgcagcgagacgatcgccgacacggccaaggtgctttcgcgctacgtcgatgccatc
atgatccgcaccacggcccatgagaggcttctggagcttgccgaaaacgccaccgtaccc
gtcatcaacgggcttactgacgacacgcatccgtgccagatcatggctgatatcatgaca
ttcgaggagcatcgcggcgatgtgaaggaccggctcttcgcgtggtcgggcgatggcaac
aacgtgctgcattccctcctagaggcgtcggcacgcttcggtttcaggttaaacatcgcc
acaccggttggcagcgagccctccgctcactatgtggagtgggcaaagacgaatggcgga
cgcgtgaccctcaccagcgacccggaagcggcggtgcgcggggccgattgcgtggtgacc
gacacctggatctcaatgggccaggagcaccgcgcgcgaggacacaatgtgttccaaccc
tatcaagtgaacgagaggctgatgagcttcgctaagaaagaggcacttttcatgcactgc
ctgcccgcccatcgcggcgaggaggtgaccgacggcgttatcgacggcccccactcggtg
gtgttcgacgaggcggagaaccgcttgcacgcccagaaagccgttctcgcctggtgcctc
ggccagtga

DBGET integrated database retrieval system