KEGG   Chelativorans sp. BNC1: Meso_1359Help
Entry
Meso_1359         CDS       T00374                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mes  Chelativorans sp. BNC1
Pathway
mes00240  Pyrimidine metabolism
mes00250  Alanine, aspartate and glutamate metabolism
mes01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Meso_1359
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Meso_1359
Enzymes [BR:mes01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Meso_1359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ABG62755
UniProt: Q11IM0
Position
complement(1452192..1453151)
Genome map
AA seq 319 aa AA seqDB search
MTDAPGFPLFPHPHLLGIKGLSPADIELLLERADAAVAISRRPEKKLATLRGRTQINLFF
EASTRTQSSFELAGKRLGADVMNMSVASSSTKKGETLLDTAMTLNAMRPDILVVRHSAAG
AAALLAQKVGCSVVNAGDGAHEHPTQALLDALTIRRKKGSIAGLVVAICGDVLHSRVARS
NILLLNALGARVRVIAPSTLLPSGIGQMGVEPFTKMGEGLAGADVVMMLRLQRERMAGTF
VPSVREYFRFFGLDAEKLKAAKEDALVMHPGPMNRGVEIASEVADGPQSVIQEQVEMGVA
VRMAVMEALLDPRRNGDGA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgcgccgggctttcccctcttccctcacccccacctcctgggcatcaagggc
ctttcgcccgccgatatcgagctcctgctcgagcgggccgacgctgccgttgcgatctcg
cggcggccggaaaagaagctcgccaccttgcgcgggcgcacccagatcaatctcttcttt
gaggcatccacccggacccagtcttccttcgagctggcggggaagcggcttggagccgat
gtcatgaacatgtcggtcgcaagctcctcgaccaaaaagggcgagacgcttctcgatacg
gcgatgacgctcaacgccatgcggcctgatatccttgtggttcgccattccgcggcgggc
gcggcggcgctgcttgcgcagaaggtaggctgctcggtggtgaatgctggcgacggcgcg
catgaacaccccacgcaggcccttctcgacgcgctcaccatacgccgcaagaaaggcagc
atcgctgggctcgtcgtcgcgatctgcggtgacgttctccactcgcgcgtcgcgcgatca
aacatccttcttctcaacgcgctcggcgcgcgtgtgcgcgtcattgccccttccaccctt
ctgccctccggcatcggccagatgggggtcgagcccttcacgaaaatgggcgaagggctt
gccggggccgatgttgtgatgatgctgaggctccagcgcgagcgcatggccggcaccttc
gtgccttccgtgcgggaatatttccgcttcttcggcctcgatgccgaaaagctcaaagcc
gccaaggaggatgcgctggtcatgcatcccggaccgatgaaccgcggagtcgagatcgct
tcggaagtggctgacggtccgcaaagcgtgatccaggaacaggtggagatgggcgttgcc
gtacgcatggcggtgatggaagccctgctcgatccgcgccgcaacggggacggagcatga

DBGET integrated database retrieval system