KEGG   Chelativorans sp. BNC1: Meso_1365Help
Entry
Meso_1365         CDS       T00374                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
mes  Chelativorans sp. BNC1
Pathway
mes00970  Aminoacyl-tRNA biosynthesis
mes01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mes00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Meso_1365
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mes03029]
    Meso_1365
Enzymes [BR:mes01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Meso_1365
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Meso_1365
Mitochondrial biogenesis [BR:mes03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Meso_1365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ABG62761
UniProt: Q11IL4
Position
1457103..1458584
Genome map
AA seq 493 aa AA seqDB search
MTELTKLTISEIRAKLADKEFTALELTEAYLSAIQTANEKLNAYITVTADKAREMAKASD
MRLMQGGARPLEGVPLGIKDLFATEGVHTQACSHILDAFKPRYESTVTTNLWADGAVMLG
KLNMDEFAMGSSNETSYYGPVVNPWREEGGNKDLVPGGSSGGSAAAVAAWLCAGATATDT
GGSIRQPAAFTATVGIKPTYGRCSRWGIVAFASSLDQAGPIARDVRDAAILLKSMASVDP
KDTTSIDIPVPDYEAAIGQSVKGLKIGIPKEYRVEGMPAEIEALWHKGIEWMRDAGAEIV
DISLPHTKYALPAYYIVAPAEASSNLARYDGVRYGLRVPGRDITEMYENSRAAGFGREVK
RRIMIGTYVLSAGYYDAYYLRAQRVRTLIKRDFEQAFEAGVDAILTPATPSAAFGIADQE
MNADPVKMYLNDIFTVTVNMAGLPGIAVPAGLDSRGLPLGLQLIGRAFDEETLFRTAHII
EQAAGKFEPKRWW
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcttacgaaactcaccatttcggaaatccgagccaaactggccgacaaggag
ttcacggcgctggaattgacggaggcgtatctttcggcaatccaaacggcgaatgagaag
ctgaacgcctatatcacggtgacggcggacaaggcgcgggagatggccaaggcttcggac
atgcgcctcatgcagggcggcgcgcggccgcttgaaggcgtgcctctcggaatcaaggac
cttttcgccacggaaggcgtgcacacccaggcctgcagccacattctcgatgcgttcaag
ccccgttacgaatcgactgtcacgaccaatctctgggccgatggcgcagtgatgctcggc
aagctcaacatggacgagttcgccatgggctcctccaacgagacttcttactacggcccg
gtggtaaacccttggcgcgaggaaggcggcaacaaggatctcgtgcccggcggctcttcg
ggcggctcggccgcggcggttgcggcctggctttgcgcgggagccaccgcgaccgatacg
ggcgggtcgatccggcaaccggcggccttcaccgcgacggtgggcataaagcccacttat
gggcgctgctcgcggtgggggatcgtcgccttcgcatcctcgctggatcaggcggggccg
atcgcgcgcgatgtgcgggacgcggcaatccttctgaagtccatggcctcggtcgatccc
aaggatacgacgtcgatcgacatccccgtgccggattacgaggccgcgatcggccagtcg
gtgaaagggctgaagatcggcattccgaaggagtaccgggtcgaaggcatgccggccgag
atcgaggcgctttggcataaaggaatcgagtggatgcgcgatgccggcgccgagatcgtc
gatatctctctgccgcacacgaaatacgcgctgccggcctattatatcgtcgcgccggcg
gaggcttcgtcaaacctggcgcgctatgacggcgtgcgttacgggctgcgggtgcctggc
cgcgacatcaccgagatgtacgagaattcgcgggcggcgggcttcggtcgcgaggtcaag
cggcgcatcatgatcggcacctatgtgctgtctgccggttattacgatgcctattacctg
cgcgcgcagagggtgcgcacgctgatcaagcgcgattttgagcaggccttcgaggcgggc
gttgatgcgatcctcacaccggcgaccccttcggcggcgttcggcattgccgaccaggaa
atgaacgcggatcctgtgaagatgtacctgaacgacattttcaccgtgacggtgaacatg
gcgggcctgccaggcatcgccgtaccggcggggctcgattccaggggcctgccgctcgga
cttcagctcattggccgcgccttcgacgaggagacgctgttccgcacggctcacataatc
gagcaggccgcgggtaaattcgagccgaagcgctggtggtaa

DBGET integrated database retrieval system