KEGG   Chelativorans sp. BNC1: Meso_1523Help
Entry
Meso_1523         CDS       T00374                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mes  Chelativorans sp. BNC1
Pathway
mes00071  Fatty acid degradation
mes00072  Synthesis and degradation of ketone bodies
mes00280  Valine, leucine and isoleucine degradation
mes00310  Lysine degradation
mes00362  Benzoate degradation
mes00380  Tryptophan metabolism
mes00620  Pyruvate metabolism
mes00630  Glyoxylate and dicarboxylate metabolism
mes00640  Propanoate metabolism
mes00650  Butanoate metabolism
mes00900  Terpenoid backbone biosynthesis
mes01100  Metabolic pathways
mes01110  Biosynthesis of secondary metabolites
mes01120  Microbial metabolism in diverse environments
mes01130  Biosynthesis of antibiotics
mes01200  Carbon metabolism
mes01212  Fatty acid metabolism
mes02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mes00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Meso_1523
   00630 Glyoxylate and dicarboxylate metabolism
    Meso_1523
   00640 Propanoate metabolism
    Meso_1523
   00650 Butanoate metabolism
    Meso_1523
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Meso_1523
   00072 Synthesis and degradation of ketone bodies
    Meso_1523
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Meso_1523
   00310 Lysine degradation
    Meso_1523
   00380 Tryptophan metabolism
    Meso_1523
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Meso_1523
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Meso_1523
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Meso_1523
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mes04147]
    Meso_1523
Enzymes [BR:mes01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Meso_1523
Exosome [BR:mes04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Meso_1523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABG62919
UniProt: Q11I56
Position
1639165..1640553
Genome map
AA seq 462 aa AA seqDB search
MSEAANTGTEPAVRPRAARRVAAATTNPEGKDERRGRKPVYLVDGARTPFLRARGKPGPF
TPVDLAVQCGRPLLDRLSFGPEEFDLVILGCVNVLADEMNPARVAALRLGMGEAMRAFTV
QINCGSGMQSIDTGFRLIEGGEADLILAGGAEALSHAPLVLSRKAAGWFAQFATAKTAWD
RAAALGAFRPDMAKPIIGLERGLTDPITDFSMGQTAEIIGHAFGVTRQAADAYALESHRR
LARAQAEGFLKGEVIASVAADGTLYDHDDGVRPDSSIEKLARLKPVFERPHGRVTPGNSS
QITDGASWVVIASEEAIEKYGLTPIARIVDSEWAALDPSVMGLGPTICSTELIKRRGLAR
EDIDLWEINEAFAAQILACLAAWEDEEYCREVLGLSVPFGTVDRDRLNVDGGAISLGHPV
GSSGNRIVLHLANAMRRLGLKRGIATECIGGGQGGAMLLEVV
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaggcagccaatacaggcaccgagccggctgtgcggccacgggccgcccgccgc
gttgcagccgcaacgaccaaccccgaaggaaaagacgagcggaggggcaggaagccggtc
tatctggtagacggcgcccgcaccccttttttgagggcgagaggtaaaccgggtccattc
acgccggtcgatcttgccgtccaatgcggcaggcctcttctcgaccggctttccttcggg
ccggaggagttcgaccttgtcatcctgggatgcgtgaacgttctcgccgatgagatgaac
cccgcccgcgtcgccgcccttcggcttggcatgggcgaggcgatgagagccttcacggtg
cagatcaattgcggctcgggcatgcagtcgatcgatacgggtttccgcctgatcgaaggc
ggcgaggccgacttgatcctggctggcggcgctgaagccctgtcccacgcaccgctcgtt
ctttccagaaaggccgccggctggttcgcacagttcgccacggcaaagaccgcctgggac
agggccgccgcgctcggcgcgttccgtccggacatggcgaaacccatcatcgggctcgaa
cgcgggctaaccgacccaattaccgatttcagcatggggcagaccgcggagatcatcggc
catgccttcggcgttacccggcaggctgctgatgcctatgcgctcgaaagccatcgcagg
ctcgcgcgcgcccaggccgaaggttttctcaagggcgaggttattgcctcggtggcagcc
gacggcacgctttacgaccatgacgacggcgtaaggccggatagctcgattgagaagctc
gcaaggttgaaacctgtctttgaacgtcctcacggacgcgtgacgcccggcaattcttcc
cagatcaccgatggggcgagctgggtcgtgatcgcatccgaggaggcgatcgaaaaatac
gggctcaccccgatcgctcgcatcgtggacagcgaatgggccgcgcttgatccatccgtc
atgggcttgggcccaaccatctgctcaaccgaactcataaagcggcgtggcctggcgcgc
gaggacatcgacctttgggaaatcaacgaggccttcgccgctcagattctcgcctgcctc
gccgcatgggaggatgaggaatattgccgcgaggtgctggggctcagcgtacccttcggt
acggttgaccgtgaccggctcaatgtcgacggcggggcgatcagcctcggccacccggtg
ggctccagcggcaaccgcattgtgcttcatcttgccaacgccatgcgcaggctcggtctg
aagcgtggcatcgccaccgagtgcatcgggggcgggcagggcggcgccatgcttttggag
gtggtctga

DBGET integrated database retrieval system