KEGG   Chelativorans sp. BNC1: Meso_1636Help
Entry
Meso_1636         CDS       T00374                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mes  Chelativorans sp. BNC1
Pathway
mes00010  Glycolysis / Gluconeogenesis
mes00051  Fructose and mannose metabolism
mes00562  Inositol phosphate metabolism
mes01100  Metabolic pathways
mes01110  Biosynthesis of secondary metabolites
mes01120  Microbial metabolism in diverse environments
mes01130  Biosynthesis of antibiotics
mes01200  Carbon metabolism
mes01230  Biosynthesis of amino acids
Module
mes_M00002  Glycolysis, core module involving three-carbon compounds
mes_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Meso_1636
   00051 Fructose and mannose metabolism
    Meso_1636
   00562 Inositol phosphate metabolism
    Meso_1636
Enzymes [BR:mes01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Meso_1636
Exosome [BR:mes04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Meso_1636
  Exosomal proteins of bladder cancer cells
   Meso_1636
  Exosomal proteins of melanoma cells
   Meso_1636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABG63031
UniProt: Q11HU4
Position
complement(1762728..1763492)
Genome map
AA seq 254 aa AA seqDB search
MTPTIRPLIAGNWKMHGTESSLGELKAIGSGFVEAAGAGADGVICVPATLLARASDILAK
TPVATGGQDCHPATSGAHTGDIAAEMLADCGASYVIVGHSERRTDHHEADEDVAAKAEAA
WRAGLTAIICIGETKIQREAGETLSVLSRQIAGSVPPGATAKNSVIAYEPVWAIGTGLTP
TVEDVAQAHAHLRAELGMKLGIEADGMRLLYGGSVKPSNAGELLSILNVDGALIGGASLK
AADFLAISAAVKGK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgacacccacaatccgccccctcatcgccggtaattggaagatgcacggcactgagagc
tcactgggtgagttgaaagccatcggcagcggttttgtggaggccgcgggagcgggagcg
gacggtgtcatttgtgtgccggcaacgctgctggcgcgcgcatccgacatattggcgaaa
acgccggttgcgacgggtggccaggactgccatccggcgaccagcggtgcccatacgggc
gatattgccgctgagatgctggccgactgcggcgcgagctacgtaatcgtcgggcattcg
gaacgccgcaccgatcatcatgaggccgatgaggatgtcgcagccaaggcggaagccgcc
tggcgcgccggcctcactgccatcatctgcatcggggaaaccaagatacagcgcgaggcg
ggcgaaacgctgtcggtgctttcccggcagattgccggttccgttccgccgggagctacg
gcgaaaaattccgtaatcgcctacgagccggtttgggccataggtaccggcctcacgccg
acggtggaagatgtggcccaggcgcacgcccatctgcgtgccgagcttggaatgaagctg
ggtattgaagccgatgggatgcggcttctatacggcgggtcggtgaagccgtcgaatgcg
ggcgaactgctttccatactgaacgtggatggggcgctgattggcggcgccagcctcaag
gctgccgatttcctcgcgatttcggcggctgttaaaggcaaataa

DBGET integrated database retrieval system