KEGG   Chelativorans sp. BNC1: Meso_2142Help
Entry
Meso_2142         CDS       T00374                                 

Definition
(GenBank) two component transcriptional regulator, winged helix family
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
mes  Chelativorans sp. BNC1
Pathway
mes02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mes00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Meso_2142
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mes02022]
    Meso_2142
Two-component system [BR:mes02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   Meso_2142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C GerE
Motif
Other DBs
NCBI-ProteinID: ABG63534
UniProt: Q11GE1
Position
2295298..2296020
Genome map
AA seq 240 aa AA seqDB search
MITREDIVAEVNAPADDAPHLLVVDDDTRIRTLLKRFLTEEGFRVTVAANAAEARRKLAG
LDFDLLVLDVMMPGEDGVGLTRSLRQERDVPILMLTALSETESRVTGLQAGADDYLPKPF
DPRELVLRVNNILRRGGQPTTPKLEQIVFGPYTFQITRRELKRAGELLKLTEREREIMAI
FAERAGETIPRHELVGEDSEVGERTIDVQINRLRRKIERDPANPIWLQTVRGIGYRLSIE
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgattacccgtgaggacatcgttgccgaggtgaatgcgccggcggacgatgcgccgcat
ctcctcgtcgttgacgatgacacgcgcattcgcacgctgctcaagcgtttcctaaccgaa
gaagggtttcgggtgacggtggcggcaaatgccgccgaagcgcgccgaaagcttgccggc
ctggatttcgacctcctcgtccttgacgtcatgatgccgggtgaggacggcgtggggctg
acgcgcagcctccgtcaggaacgtgacgtgccaattcttatgctgacggcgctttccgaa
accgaaagccgcgtgacgggcttgcaagcgggcgccgacgattatctgccaaagccgttc
gacccgcgtgaactcgtgctgcgcgtcaacaatatccttcgccgtggtggacagccgacc
acgccgaagctggagcagattgtcttcggtccctacaccttccagatcaccaggcgagag
ctgaaacgcgccggcgagctattgaaactgaccgaacgcgagcgtgaaatcatggccatc
tttgccgagcgcgcaggcgagaccattccacgccacgagctggtgggcgaggattcggag
gtgggcgaacgcacgatcgacgtgcagatcaaccggctgcgccgcaagatcgagcgcgat
cccgccaacccgatctggctgcagaccgtacgcggaatcggctatcgcctgagcattgag
taa

DBGET integrated database retrieval system