KEGG   Chelativorans sp. BNC1: Meso_2524Help
Entry
Meso_2524         CDS       T00374                                 

Definition
(GenBank) aldehyde dehydrogenase (acceptor)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mes  Chelativorans sp. BNC1
Pathway
mes00010  Glycolysis / Gluconeogenesis
mes00053  Ascorbate and aldarate metabolism
mes00071  Fatty acid degradation
mes00280  Valine, leucine and isoleucine degradation
mes00310  Lysine degradation
mes00330  Arginine and proline metabolism
mes00340  Histidine metabolism
mes00380  Tryptophan metabolism
mes00410  beta-Alanine metabolism
mes00561  Glycerolipid metabolism
mes00620  Pyruvate metabolism
mes00625  Chloroalkane and chloroalkene degradation
mes00903  Limonene and pinene degradation
mes01100  Metabolic pathways
mes01110  Biosynthesis of secondary metabolites
mes01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mes00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Meso_2524
   00053 Ascorbate and aldarate metabolism
    Meso_2524
   00620 Pyruvate metabolism
    Meso_2524
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Meso_2524
   00561 Glycerolipid metabolism
    Meso_2524
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Meso_2524
   00310 Lysine degradation
    Meso_2524
   00330 Arginine and proline metabolism
    Meso_2524
   00340 Histidine metabolism
    Meso_2524
   00380 Tryptophan metabolism
    Meso_2524
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Meso_2524
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Meso_2524
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Meso_2524
Enzymes [BR:mes01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Meso_2524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh TetR_C_27
Motif
Other DBs
NCBI-ProteinID: ABG63908
UniProt: Q11FB7
Position
2703612..2705141
Genome map
AA seq 509 aa AA seqDB search
MIKEALLQTTMKSLEGSRQELFIGGRFRAPSSGRFIPSFDPTTGEVWYEFAEADAADVDA
AVTSATKAFHNPAWRRMTQTDRGKLIRRLAELVLEHADELALMETRDNGKLIKEMMAQMR
AMPDSYIYFAGMADKLQGDTIPVNKLDSLNYSQREPLGVVGMITPWNSPLMLLTGTLAPC
LAIGNTVVVKPSEHATASTLALAELVVEAGIPEGVVNVVTGTGAVTGEALTRHPGLAKIV
FTGSTATGRRIAANAAENLIPCQMELGGKSPHVVFSDVDIERAVNGVVSGIFAAAGQTCV
AGSRCFVEANIYDRFLEALVERTRHIRVGHPMEESTDVGPLAMKSQLEKIEGYVASGARD
GAKIAVGGRRPKDGDLARGWYFEPTVMADARNDMKFMRDELFAPVVGVMPFRDEAEMITL
ANDTEYGLASGIWTRDIDRAMRFASQIDAGTVWINTYRSAAYMSANGGFKNSGYGRRGGF
DVMREFSRSKNVLIDYSGAMQDPFVIRLK
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ttgatcaaggaggccctcttgcaaactaccatgaagtcattggaaggctcgcgtcaggag
ctgttcatcggcggtcgcttccgtgcaccgagcagcggccggtttattcctagcttcgat
ccgaccaccggcgaggtctggtacgagtttgccgaggccgacgccgccgatgtcgacgcc
gccgtcacctcggcgaccaaggcgttccacaatccagcctggcggcggatgacccagacc
gatcgcggcaagctcattcgccgcctggccgagctggtactggagcatgccgacgagctg
gctctgatggagacccgcgacaatggcaagctgatcaaggaaatgatggcgcagatgcgc
gccatgcccgacagctatatctatttcgccgggatggccgacaagcttcagggcgacacg
attccggtcaacaagctggactccctcaactattcgcagcgcgagccgcttggcgtcgtc
ggcatgattacgccgtggaattcgccgctgatgcttctcaccggcacgctcgcgccgtgc
cttgccatcggcaacacggttgtggtgaagccctcggaacatgccactgcatcgacgctg
gcgctggccgaactggtggtcgaggccggcatacccgaaggcgtcgtcaatgtggtgacc
gggacgggcgccgtcacgggcgaggcgctgacgcgccatcccggcctggcgaaaatcgtc
tttaccggcagcaccgcgacgggccgccgcatcgccgcgaacgccgcagaaaatcttatt
ccttgccagatggagctaggaggcaaatccccccatgtggtgttctcggatgtggacatc
gagcgcgcagttaacggcgtcgtctcggggattttcgcggcggcgggtcagacctgcgtc
gcaggttcgcgctgcttcgttgaggccaatatctatgatcgcttcctcgaagcgctcgtc
gagcgcacacggcatatccgcgttgggcacccgatggaggaaagcaccgatgttggaccg
ctcgcgatgaaatcccagcttgaaaagatcgagggctatgtcgcctcgggtgcgcgcgat
ggtgcgaaaatcgcggtcggcgggcgccgcccgaaggacggcgatctggcccgcggctgg
tatttcgagccgaccgtcatggccgatgcgcgcaacgacatgaaattcatgcgtgacgag
ctgttcgcgccggtggtgggcgtgatgccgttccgggacgaggccgagatgatcacgctg
gccaacgataccgaatacgggctcgcctcgggtatctggacccgcgacatcgaccgcgcc
atgcgcttcgccagccagatcgacgctggcacggtgtggatcaacacctaccgctccgcc
gcctacatgtcggccaatggcggcttcaagaacagcggatacggccggcgcggcggcttt
gacgtgatgcgggaattctcgcgctccaagaacgtgctgatcgactattcgggcgccatg
caagatccctttgtcatccgcctgaagtga

DBGET integrated database retrieval system