KEGG   Chelativorans sp. BNC1: Meso_2739Help
Entry
Meso_2739         CDS       T00374                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mes  Chelativorans sp. BNC1
Pathway
mes00040  Pentose and glucuronate interconversions
mes00052  Galactose metabolism
mes00500  Starch and sucrose metabolism
mes00520  Amino sugar and nucleotide sugar metabolism
mes01100  Metabolic pathways
mes01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Meso_2739
   00052 Galactose metabolism
    Meso_2739
   00500 Starch and sucrose metabolism
    Meso_2739
   00520 Amino sugar and nucleotide sugar metabolism
    Meso_2739
Enzymes [BR:mes01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Meso_2739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABG64116
UniProt: Q11EQ9
Position
complement(2980044..2980928)
Genome map
AA seq 294 aa AA seqDB search
MKKIRKAVFPVAGLGTRFLPATKALPKEMLTVVDKPVIQYVVDEAREAGIEHFIFVTGRN
KTAIEDHFDVAVELYETLSRRGKTEILERLKAMQPEPGQTGYTRQQVPLGLGHAVWCARE
LVGNEPFALLLPDMIMQSEPGCMKQMVELYMETGGNILAVEECDPAETQKYGIVGRGKET
HGGFEITSMVEKPKPKDAPSNFYINGRYILQPEIFSLLEDQETGAGGEIQITDAMLRLHA
KEPFYAHIFRGRTFDCGSPEGFIKANIALALQQETLKPQVLGFLKDFLEEEGLA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagatccgtaaagccgttttccccgttgcaggcctgggcacccgcttcctgccg
gcaacgaaagcgcttcccaaggaaatgctgacggttgtcgataagccggtcatccaatat
gtcgtggacgaagctcgcgaagcgggcatagagcatttcatcttcgtcaccgggcgaaac
aagaccgcaatcgaggatcatttcgatgtggccgtggagctctacgagacgctgtccagg
cgtggaaaaaccgaaatactcgagcggctgaaggccatgcagcctgaacccggccaaacg
ggttatacgcgccagcaggtgccgctggggctcggacacgctgtgtggtgcgcacgcgag
ttggtggggaatgaacctttcgcgctgctgctgcccgacatgatcatgcaatcggaaccc
ggctgcatgaagcagatggtcgaactctatatggagaccggcgggaatatccttgcggtg
gaagaatgcgatccggccgagactcaaaaatatggcattgtcgggcggggcaaggaaacc
catggcggctttgaaatcacgtccatggtggagaagccaaagccgaaggacgccccttcc
aacttctacatcaatggccgctatattctgcagcccgagatcttttcactcctcgaagat
caggagacgggcgcggggggcgagatccagatcaccgatgccatgctgcggctgcacgcg
aaagaaccattttacgcgcatatctttcgcgggcggactttcgactgcggctcgccggag
gggttcatcaaggcgaatatcgcgcttgccctgcagcaggaaacgctaaagccgcaggtg
ctcggtttcctgaaagattttctcgaagaagaggggttggcctga

DBGET integrated database retrieval system