KEGG   Chelativorans sp. BNC1: Meso_2800Help
Entry
Meso_2800         CDS       T00374                                 

Definition
(GenBank) SSU ribosomal protein S21P
  KO
K02970  small subunit ribosomal protein S21
Organism
mes  Chelativorans sp. BNC1
Pathway
mes03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mes00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Meso_2800
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mes03011]
    Meso_2800
Ribosome [BR:mes03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    Meso_2800
  Bacteria
    Meso_2800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S21 DUF2188 CAP59_mtransfer
Motif
Other DBs
NCBI-ProteinID: ABG64176
UniProt: Q11EJ9
Position
3047941..3048171
Genome map
AA seq 76 aa AA seqDB search
MQVLVRDNNVDQALRALKKKMQREGIFREMKMRGHYEKPSEKRAREKAEAVRRARKLARK
RAQREGLVSGRPAAAR
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggtactcgtccgcgacaacaatgttgaccaggcgcttcgcgcgctgaaaaagaag
atgcagcgcgaaggcattttccgcgagatgaaaatgcgcggccattatgaaaagccgtct
gaaaagcgggcacgggagaaggcagaggccgtgcggcgcgcacgcaagttggcgcgcaag
cgcgcccagcgggaaggcctcgtcagtggacggccggcggcggcgcgctga

DBGET integrated database retrieval system