KEGG   Chelativorans sp. BNC1: Meso_3159Help
Entry
Meso_3159         CDS       T00374                                 

Definition
(GenBank) Adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
mes  Chelativorans sp. BNC1
Pathway
mes00230  Purine metabolism
mes00250  Alanine, aspartate and glutamate metabolism
mes01100  Metabolic pathways
Module
mes_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:mes00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Meso_3159
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Meso_3159
Enzymes [BR:mes01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     Meso_3159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: ABG64531
UniProt: Q11DJ4
Position
complement(3428101..3429399)
Genome map
AA seq 432 aa AA seqDB search
MANVVVVGSQWGDEGKGKIVDWLSERADVVVRYQGGHNAGHTLVIDGVSYKLSLLPSGVV
RSGKLSLIGNGVVFDPHAFVAEIERLKGQGISVTPESLKVAENTALILSLHRELDAFRED
AASNSGTKIGTTRRGIGPAYEDKVGRRAIRVMDLADPETLSLKVDRLLTHHNALRRGLGH
AEVSHEAIMQELTSVADKILPFVDRVWKILEDARRAGSRILFEGAQGTMLDIDHGTYPFV
TSSNTVAGQAATGSGLGPGAVGYVLGITKAYTTRVGEGPFPTEQDNEIGEFLGNRGHEFG
TVTGRKRRCGWFDAVQVRQSVVTNGMSGIALTKLDVLDGMEEIKVCTGYRLDGQVIDYLP
ASQGAQARLDPIYETLEGWKETTRGARKWNDLPAQAVKYVRHIEELIGAPVAILSTSPER
EDAILVKDPFQD
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatgtggtggtcgtcggctcgcagtggggcgacgaaggcaagggaaaaattgtc
gattggctttccgagcgcgcggatgtggtcgtgcgttatcagggtggccacaacgctggc
catacgcttgtgatcgatggggtgagctacaagctttcgctgctgccctcgggagtggtg
cggtcgggcaagctctccctcatcggcaatggtgtcgtgttcgatccccatgccttcgtg
gcggaaatagagaggctgaaagggcagggcatctctgtgacgccggaaagcctgaaggtc
gcggaaaacacggcactcatactgtcgctgcacagggaactcgacgcgttccgggaggat
gccgcctcaaattcgggaaccaagatcgggaccacccgccgcggcatcggtccggcctat
gaagacaaggtaggacggcgcgccatccgcgtcatggatcttgccgacccggagacacta
tcgctcaaggtggaccggctgctgacccatcacaatgcgcttcgccgcggcctggggcac
gccgaagtctcccacgaggccatcatgcaggagctgacctcggtggccgacaagatcctg
cccttcgtcgaccgggtgtggaaaatacttgaggatgcccgccgcgccggcagccgcatc
ctctttgagggtgcccaaggcacgatgctcgatatcgatcatggcacctatccgttcgtg
acctcctcgaacacggttgctggccaggccgccaccgggtccggtctgggtcccggtgcg
gtgggctatgtgcttggcattacaaaagcctatacgacgcgcgtgggcgaagggcccttc
ccgaccgagcaggacaacgagatcggtgaatttctgggcaaccgcggacatgaattcggg
accgtcaccggccgtaaacgccgctgcggttggttcgatgcggtgcaggtgcgccagtcc
gtggtgacaaacggcatgagcggcatcgccctcaccaagctcgacgtgctcgacgggatg
gaggagataaaggtctgcacgggctacaggctggacggccaggtgatcgactatcttccc
gcgagccaaggcgcgcaggcgcggctcgacccgatctacgagacgctggaaggctggaag
gaaacgacgcgcggcgcccgcaaatggaatgatttgcctgcgcaggcggtgaagtatgtc
cgccatatcgaagagcttatcggcgcgccggtcgcgattttgtcgaccagtccggagcgg
gaggatgcgatcctggtaaaggacccgttccaagactag

DBGET integrated database retrieval system