KEGG   Chelativorans sp. BNC1: Meso_3245Help
Entry
Meso_3245         CDS       T00374                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mes  Chelativorans sp. BNC1
Pathway
mes00020  Citrate cycle (TCA cycle)
mes00190  Oxidative phosphorylation
mes00650  Butanoate metabolism
mes01100  Metabolic pathways
mes01110  Biosynthesis of secondary metabolites
mes01120  Microbial metabolism in diverse environments
mes01130  Biosynthesis of antibiotics
mes01200  Carbon metabolism
Module
mes_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mes_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mes_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Meso_3245
   00650 Butanoate metabolism
    Meso_3245
  Energy metabolism
   00190 Oxidative phosphorylation
    Meso_3245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS DUF962
Motif
Other DBs
NCBI-ProteinID: ABG64617
UniProt: Q11DA8
Position
complement(3512890..3513273)
Genome map
AA seq 127 aa AA seqDB search
MADMRTPLNKVRGLGSARGGTEHFWRQRLTAVSNIPLIIFFIGFVAAYSGSSYEEIRAAL
AQPVSALLMGLAFVSVLYHMRLGMQVIIEDYVHGEGWKIALILLNTFFPVIVGAIALYSL
LRIAFGG
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggcggatatgcgcacacctctcaacaaggtccgcggtctgggctcggcgcgcggcggc
acggagcacttttggcgccagcggctgacggcggtctccaatatcccgctcatcatcttc
ttcatcggctttgtggcagcttattccggatcctcctacgaggagatccgggcagcgctt
gcgcagcctgtcagcgcgctccttatgggccttgccttcgtttcggtgctgtaccacatg
cgcttgggaatgcaggtgatcatcgaggattacgtgcatggcgagggctggaagatcgca
ctcatcctcctcaatactttctttcccgtcatcgtcggcgcgatcgcgctctattccctc
ctcagaattgccttcggaggctga

DBGET integrated database retrieval system