KEGG   Chelativorans sp. BNC1: Meso_3855Help
Entry
Meso_3855         CDS       T00374                                 

Definition
(GenBank) conjugal transfer protein trbJ
  KO
K20266  type IV secretion system protein TrbJ
Organism
mes  Chelativorans sp. BNC1
Pathway
mes02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mes00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Meso_3855
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mes02044]
    Meso_3855
Secretion system [BR:mes02044]
 Type IV secretion system
  Trb secretion system protein
   Meso_3855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLU-1 Nicastrin DUF948 Mod_r DUF4141 Spc7 Vps5 FapA
Motif
Other DBs
NCBI-ProteinID: ABG65222
UniProt: Q11BK3
Position
4157568..4158329
Genome map
AA seq 253 aa AA seqDB search
MTRNSACRIVGVSAIAITLAAPLALAPVVSTPAHAQLFGFGRIVFDPTNYAENLLTAARS
LEQINNQIQSLQNEAQMLINQARNLASLPHSSLQQLQQAVSRTQQLLGEAQRIAFDVREI
DQIFDNQYANVDLSMTDRQLVDQARDRWGNTVGALQDAMRVQAGVVGNIDAQRTEMSALV
GQSQNAVGALQATQAGNQLLALQAQQLADLTAMLAANGRATALVDAERAAAAEQGRVQRQ
RFLTPGPGYQPGN
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgacccgaaattccgcctgccggatcgtcggcgtgagcgccatcgccatcacacttgca
gccccgcttgcacttgcgccggtcgtttcgacgccggctcacgcgcagctcttcggcttc
ggccggatcgtcttcgatccgaccaactacgccgaaaaccttctcacggcggcgcgctct
cttgagcagatcaacaaccagatccagtcgcttcagaacgaagcgcagatgctcatcaac
caggcccgtaatcttgccagcctgccgcactcctcgctccagcagctccagcaggctgtc
tcgcgcacccagcagcttctcggcgaggcgcagcgtatcgctttcgacgtccgcgagatc
gaccagatcttcgacaatcaatacgccaatgtcgatctctcgatgacggaccggcagctc
gtcgatcaggcgcgagatcgctgggggaacacggtcggcgcgcttcaggacgccatgagg
gtgcaggcgggcgtcgttggcaatatcgacgcccagcggaccgagatgtccgccctcgtc
gggcagagccagaacgcggtcggcgcgcttcaggcgacccaggccggcaaccagcttctc
gcgcttcaggcgcaacagctcgccgacctcaccgccatgctcgcagccaacggccgtgcc
accgctctcgtcgatgccgaacgcgcggctgccgccgagcaggggcgcgtccagcggcag
cggttcctcacccccggccccggctaccagccgggcaactag

DBGET integrated database retrieval system