KEGG   Chelativorans sp. BNC1: Meso_3860
Entry
Meso_3860         CDS       T00374                                 

Definition
(GenBank) conjugation TrbI-like protein
  KO
K20533  type IV secretion system protein TrbI
Organism
mes  Chelativorans sp. BNC1
Pathway
mes02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mes00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Meso_3860
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mes02044]
    Meso_3860
Secretion system [BR:mes02044]
 Type IV secretion system
  Trb secretion system protein
   Meso_3860
SSDB
Motif
Pfam: TrbI Tom5
Other DBs
NCBI-ProteinID: ABG65227
UniProt: Q11BJ8
Position
4161642..4162808
AA seq 388 aa
MTANETGKGEGIGAADTATTMRLRAEAPSVTRVSRKVLTGLGLIAGLGIGGALIYALQTA
DRQRQGEELFTTDRRQTADGLQGLPSDYSGIPQLGPPLPGDLGGPIVRSREEGRPIPVET
MPMPQADPEEQRRLAEMEAARTSQLFFQTRSDTSSGLPSFQPNFGGATSPTGSGSQDRHL
TFLNAEVDRRTVAPDRVAAPASPYVLQAGSVIPAALITGIRSDLPGQITAQVTQHVYDSP
TGSLVLIPQGTRIIGEYDAGVTFGQRRILLVWNRLIFPNGRSIVLERQPGVDTQGYAGLE
DQVDYHWWDLAKAAGLSTLLAIGTNMAMSDEDRLIQAIRRGAGDTVNDAGQQIIQRQLQV
APTLTIRPGFPMRVVVTRDLVLEPYAAH
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgaccgccaacgagaccggaaagggagaggggatcggcgcggccgacacggcaacgacc
atgcggctgcgggcggaggcgccaagcgtcacccgcgtctcgcgcaaggtgctgaccggg
ctcggcctcattgccggcctcggcatcggcggtgcgctgatctatgcgctccagaccgcc
gatcggcagcggcaaggcgaggagctgttcaccaccgaccgccgccaaacggccgatggt
ttgcaggggctgccgtccgactacagcggcatcccacaattgggaccaccacttccgggc
gatctgggaggaccgatcgtgcgctcccgtgaggaaggccggcccattccggtagagacc
atgccgatgccgcaggctgacccggaggagcagcggcggcttgcggagatggaggccgca
cgcaccagccagctcttttttcagacccgctcggacaccagctccggcctgccatccttc
cagccgaacttcggcggcgcgactagcccgacaggttccgggagccaggacaggcatctg
accttcctcaacgccgaggtcgaccggcgaacggtggcgccggatcgcgtcgctgcacca
gcctcgccctacgttcttcaggccggatcggtgatcccggcggccctcatcaccggcatt
cgatcggacctgcctgggcagatcacagcacaggtcacccaacacgtctacgactccccc
accggaagccttgtcctgattccgcaggggacccggatcatcggggagtacgacgccggt
gtcacattcggtcagcgccggattttgctggtgtggaatcgcctgatcttcccgaacgga
cgctccatcgtcctcgaaaggcagccgggcgtcgatacccagggctatgcgggcctcgaa
gatcaggtcgactatcattggtgggacctggccaaggccgctggtctttcaacgctgctt
gcgatcggcacaaacatggccatgagcgacgaggacaggcttatccaggcgatccgccgg
ggcgctggcgacacggtcaacgacgcgggccagcagatcatccagcgacaattgcaggtc
gccccgaccctcacaatccgtccggggttcccgatgcgcgtcgtcgttactcgcgacctc
gttctcgagccctacgccgcacactga

DBGET integrated database retrieval system