KEGG   Chelativorans sp. BNC1: Meso_3963Help
Entry
Meso_3963         CDS       T00374                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
mes  Chelativorans sp. BNC1
Pathway
mes00220  Arginine biosynthesis
mes00330  Arginine and proline metabolism
mes01100  Metabolic pathways
mes01110  Biosynthesis of secondary metabolites
mes01130  Biosynthesis of antibiotics
mes01230  Biosynthesis of amino acids
Module
mes_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Meso_3963
   00330 Arginine and proline metabolism
    Meso_3963
Enzymes [BR:mes01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Meso_3963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase Collagen_mid
Motif
Other DBs
NCBI-ProteinID: ABG65330
UniProt: Q11B95
Position
complement(4267192..4268121)
Genome map
AA seq 309 aa AA seqDB search
MRCKILGAPVQDGAGCRGCDMGPSALRVAGLVEALSELGHTVEDLGNVSPKLQSPLAHPN
SVLRSLSEIAGWTAALAEAAYRASADALPIFLGGDHSISAGTVSGIAQRAAELRRPLFVL
WLDAHTDFHTLDSTVSGNLHGVPLAYATGQPGFDGYFPPLMAAVDPFRTCVMGIRSIDPA
ERIAINEAGVTMYDMRAIDEHGVAPLLRAFLERVASQDGLLHVSLDVDFLDPSIAPAVGT
TVPGGATFREAHLVMEMLHDSGLVSSLDLVELNPFLDERGRTATLMVDLASSLMGRRIMD
RPTRSYSHG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcgttgcaaaatcctgggggcacccgttcaagacggtgcagggtgcagaggatgcgac
atgggcccgagcgcgcttcgcgtcgcgggattggtcgaagcattgagcgagcttggccac
acagtcgaggatctgggcaatgtgagccccaagcttcagtctccacttgcccatccgaac
tcagtcctcaggtcattatccgagatcgccggctggaccgccgctcttgcagaggcggcc
tatcgcgccagcgccgacgcgctgcccatctttctcggcggcgaccacagcatatccgct
ggaacggtttccggcatcgctcaacgggctgcagaactcaggcgtccgcttttcgtgtta
tggctcgatgcgcacaccgatttccacacgctggacagcacggtgagcggcaaccttcat
ggggtgccgctggcctatgccaccggacaaccgggcttcgacggctatttccctccgcta
atggccgccgtcgatccattccgcacctgcgtaatgggcatccgcagtatcgatcccgct
gaacgtatcgccatcaatgaggcgggcgtgaccatgtacgatatgcgcgccatcgacgag
cacggcgttgcgccgcttctgcgcgcttttctggagcgggtcgcctcgcaggacggactg
ctgcatgtcagcctggacgtcgacttcctcgatccctcgatcgcgccggcggtcggcacc
accgtgccgggcggagcgacctttcgcgaggcacatctggtgatggaaatgctgcacgat
agcggcctcgtcagcagtctggacctggtcgagctcaatccctttctcgatgaacgtggc
cgcacggcaaccctgatggtcgatctggcctccagcctgatgggacgccgcattatggac
cggccgacgcggagctactcacatggataa

DBGET integrated database retrieval system