KEGG   Chelativorans sp. BNC1: Meso_4342
Entry
Meso_4342         CDS       T00374                                 

Definition
(GenBank) putative type IV secretion system protein VirB7
  KO
K03202  type IV secretion system protein VirB7
Organism
mes  Chelativorans sp. BNC1
Pathway
mes03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mes00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Meso_4342
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mes02044]
    Meso_4342
Secretion system [BR:mes02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Meso_4342
SSDB
Other DBs
NCBI-ProteinID: ABG61312
UniProt: Q11MQ7
Position
p1:complement(244785..245075)
AA seq 96 aa
MHIVRVVTMMGLLAAVSGCATLSYPLPKCDGYAKRPLNRSMWDWDAGKAQGNPQQQSSRA
GGDALALAFAEHEPTVATVAFAGFDEAGSHAACRAG
NT seq 291 nt   +upstreamnt  +downstreamnt
gtgcatatagttcgagttgtaacaatgatggggctgctggcggcggtctccggctgcgcg
acgctaagttacccgctgcccaaatgcgacggttacgcgaagcgtccgctcaatcgttcg
atgtgggattgggatgccgggaaagcacagggcaatccgcaacagcaatcctcgcgcgct
ggtggcgacgcgttagccttggcgttcgccgagcatgaaccaaccgtcgcgaccgtagcc
ttcgccggattcgacgaagccggctctcacgccgcttgccgggcagggtag

DBGET integrated database retrieval system