KEGG   Manihot esculenta (cassava): 110599831Help
Entry
110599831         CDS       T05761                                 

Definition
(RefSeq) protein PHYLLO, chloroplastic isoform X1
  KO
K14759  isochorismate synthase / 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase / 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase / O-succinylbenzoate synthase [EC:5.4.4.2 2.2.1.9 4.2.99.20 4.2.1.113]
Organism
mesc  Manihot esculenta (cassava)
Pathway
mesc00130  Ubiquinone and other terpenoid-quinone biosynthesis
mesc01100  Metabolic pathways
mesc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    110599831
Enzymes [BR:mesc01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     110599831
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     110599831
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     110599831
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     110599831
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N MR_MLE_C TPP_enzyme_M_2 Abhydrolase_6 Abhydrolase_1 Hydrolase_4 TPP_enzyme_C Abhydrolase_2 Ndr BAAT_C DLH DUF676 Chlorophyllase2 Abhydrolase_3 Chlorophyllase Esterase Thioesterase DUF900 TPP_enzyme_M LIDHydrolase
Motif
Other DBs
NCBI-GeneID: 110599831
NCBI-ProteinID: XP_021592103
Position
LG14
AA seq 1722 aa AA seqDB search
MKPHILLATNLWILPSLNLHSRIRRSPPTLAFPNRNTAIHFNLLRRPAILSPNFKVVEAV
RFDGPIITIEGLEDCELVIETCITRTLSPVVTLERGLQSIREAVEELKLNHPPSSSGILR
FQVAVPPGPKALNWFCCQLESSRVFPQFFVSKEAENPSCKSLYLNRTRGVFGIGAAIYFI
QSSHTVGEHKSIRRYVSSDSVNMATYGFVDAKFDTFSSSIKHEAGSFYLVIPEIELDEHE
DFSILSATLAWDAALFCTFKQAIQSFESSIYEVGYHFCPTGEKCGFNNIRSALNRVNPVE
DKTFRMVSSNAVLLDRRDYQNNLLELRGTAFFCQFYFRISPIIGISHNMLDHASEACCSL
LDCANINEVWASLIVEECSRLGLTYFCIAPGSRSSPLAIAASTHPLTTCIACFDERSLAF
HAVGYARGSHRPAVVITSSGTAVSNLLPAVVEASQDFVPLLLLTADRPPELQNAGANQSI
NQVNHFGSFVRFFFSLPAPTDNIPARMVLTTLDSAVHWSTSSPYGPVHINCPFREPLDNS
PSKWMLSCLKGLDKWMSSAEPFTKYIQMQNSLACYENTVISMKQVIEIIQQAKRGLLLVG
AIHTEDEIWAALLLAKHLNWPVVADILSGLRLRRLSSYFPKDEENVLFIDHLDHALLSDF
VKGWVRFEVVIQIGSRITSKRISQMLEDCCPCSYILVDNHPCRHDPSHFVSHRVQCSILQ
FVDSLNKVQFPCRSSIWCDYLGALDKMVARDISFQIHVENSLTEPHVAHVISGALSAGSA
LFIGNSMVIRDADMYGYSYDHHIHRIADILNSEHHGLGIQVVGNRGASGIDGLLSTAIGF
AVGCNKRILCVIGDVSFLHDSNGLSILNPRMSRKPMTIIVINNHGGAIFSLLPIADGTDQ
RTLNQYFYTSHNISIQKLCMAHSVQHSHVKTKMELQDALVASQHQKTDCVIEVESSISDN
AIFHSTLRKSGCQAADRALSILSRLSVPYSVSDRFFLCKILKMEYSLYRIELSAPPTSSS
VDHDCNKFHKEGYILSLSLEDGSVGYGEVAPLEIHKENLLDVEEQLQFLLHVIKGTKISL
SLPLMSGSFSSWIWNNLGIPENSIFPSVRCGLEMAILNAIAERQGCSLLNIIQPWRETEK
ICEKSNVKICGLIDSTGTPAEVAVIASALVEEGFSALKLKVARRIDPIQDAAAIQEVRKK
VGRQIELRVDANRNWSYEEAIRFGSLVKDCDLQYIEEPVQDENDIIKYCEESGLPVALDE
TIDKICENPLDMLMKYAHPGIVAVVIKPSVVGGFERAALIAQWAHRQGKMAVVSAAFESG
LSLLTYIQFSYYLELQNADICGVMNYKLRPSIAHGLGTYQWLKQDVTTKPLEIRRHPHSG
FMGASVADNIQLLQMFQINHNVIYRTSTGDQVHRYNLAVSSMDFTCSIKVHEVGEKNNDN
VVIFLHGFLGTGEDWISIMKAISGSARCISIDLPGHGGSKIQNCGCEEAKEEATLSVEMV
AHILYKLIPDITPKKVAIVGYSMGARIALRMALRHSDKVSGAVIISGSPGLKDGQERKIR
QARDFSRSRTLMDYGLQLFLDSWYAGELWNSLRSHSRFKEIVASRMLHDDVYSLAKVLSD
LSVGRQMPLWEELKQCNIPLLLMVGEKDKKFQAIAEKMYSEICQFEKGKEDDMGINVPEI
VKIPNCGHAVHLENPLPVIGELRRFLTKLRKFSTLEHTENMH
NT seq 5169 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctcacatattactcgcaaccaatctctggattctaccgtctctaaatcttcat
tctcgtatcagaaggtctccaccaactctcgcattccccaaccggaacactgccattcac
ttcaatcttcttcgccgccctgcaattctaagccctaatttcaaggttgtggaagcggtg
agatttgatggcccgataatcactattgagggtttggaggactgtgagttggtgatagag
acctgcattacgcgtactttgtctccggttgtgacgctggagcgcggtcttcagagcatt
cgagaggctgtggaagaattgaagttgaatcatcctccttctagcagtggaattttgaga
ttccaggttgctgtgcctcctggtccaaaagctttgaattggttctgctgtcaactagaa
tcatctagagtgtttcctcaattttttgtttctaaggaggctgaaaatccatcatgtaaa
tctctctatctgaacagaacacgtggagtttttggaattggagctgcaatttactttatt
cagtcctctcatacagtgggggagcataaatcaataaggaggtatgtctcaagtgattct
gtgaacatggcaacttatggtttcgtggatgctaagtttgatactttctcatcttcaatt
aagcatgaggctggttcgttttatcttgtaattcctgagattgaattagatgaacatgag
gacttctccattttatcagcgaccctagcatgggatgctgccttgttttgcacatttaaa
caagcaattcaatcttttgagtcatctatttatgaggtgggttatcatttttgcccaact
ggagaaaaatgcggttttaataacataaggtccgctctcaatagggtcaatccggtggag
gataaaactttcagaatggtttcttctaatgctgtgttgttggacagaagagattatcag
aataacctcctggaactgagagggaccgcatttttctgtcaattttatttcaggatttca
ccaattattggcatttcccataacatgttggatcatgccagtgaagcatgttgctccttg
ctagattgtgcaaacatcaatgaagtttgggcatcactaatagtggaagaatgttcacgt
cttgggttaacgtacttctgcattgctccaggatcaagatcatcccctcttgccattgct
gcttccactcatcccttaacaacatgtattgcttgctttgatgagcgctcgttggcattt
catgctgttggttatgcaagaggttctcatagaccagcagttgttataacatcttcagga
actgcagtgtcaaatctccttcctgctgttgtggaagccagtcaagattttgtgccactt
ctcttactaactgccgatcgtcctcctgagcttcaaaatgctggggcaaatcaatctatc
aatcaggtgaaccattttggttcttttgtaaggttcttcttcagtcttccagcacctact
gataatattcctgcacggatggtgcttacgacacttgactctgctgtgcattggtcaacg
tcttcaccatatggccctgttcatattaactgtccttttagagagccattggataattct
ccaagcaagtggatgttaagttgtttgaagggcttagataaatggatgtctagtgcggag
cccttcactaaatatattcaaatgcaaaattcccttgcatgctatgaaaatactgttatc
tcaatgaaacaagttattgaaataattcagcaggctaaaagagggcttctccttgttggt
gcaattcatactgaagatgagatatgggcagctcttctcttggctaaacaccttaattgg
ccggttgtagctgacatcttgtcaggtttacgattaagaaggctttcatcttattttccc
aaagatgaagagaatgttttatttattgatcatctagaccatgctctgctctcagatttt
gtcaagggttgggtgcggtttgaagtagttattcagattggaagtcgaataacaagcaaa
cgcatttctcagatgctggaagattgttgcccatgttcatatatcttagttgacaatcat
ccatgccgtcatgatccatcacattttgtatctcacagggtgcagtgctccattcttcag
ttcgtcgacagtttaaacaaagttcaatttccatgtaggagcagtatatggtgtgattat
ctgggagctttagacaagatggttgcacgggacatatcttttcaaattcatgtagagaac
tctttgactgagccacatgttgcacatgtaatttcaggagcactttcagctggctctgct
ctttttattggcaacagcatggtgatacgtgacgcagacatgtatggatatagttatgac
caccatattcatcgcattgcagatatattgaactcagaacatcatggtcttgggattcag
gtggttggaaacaggggagctagtggcattgatggcttacttagcacagcaattggtttt
gcagttggatgcaacaagagaatactttgtgtgattggagatgtttccttccttcatgat
tcgaatggcttgtcgattctcaatccaaggatgtcaagaaagccaatgacaataattgtg
ataaacaatcatggtggagcaatcttcagcctccttcctattgcagatggtactgatcaa
aggacactgaatcagtacttctacacttcccataacatttcaattcaaaagttatgtatg
gcgcacagtgtgcaacattcacatgtgaagacaaaaatggaacttcaagatgctttagta
gcatctcagcatcagaaaacagattgtgtaattgaagtggagagcagcattagtgacaat
gcaatcttccacagtactttaagaaaatctggatgccaagcagcagatcgggctctaagc
attctttcaaggctttctgttccatattcagtttcagataggttctttctttgcaagatc
ctcaaaatggaatactcgctctacagaattgaactttctgctcctcctacttcatcttca
gtagaccatgattgtaataagttccataaggaaggctacattttatcactgtctcttgaa
gatggaagtgtcggatatggtgaggttgcacctcttgaaatccacaaagaaaatttgctg
gatgtagaagagcaactccaatttctccttcatgtgattaaaggaaccaagattagttta
tcccttcctctgatgagtggctcattttcttcttggatatggaacaacctaggaatccca
gaaaattcaatctttcctagtgtcagatgtggtttagaaatggccatcctcaatgctatt
gcagaaaggcaaggctgcagtttactaaacataatccaaccctggagagaaacagaaaag
atttgtgaaaagtcaaatgttaagatatgtggcctaattgattctactgggactccagct
gaggttgctgttattgcttctgctcttgttgaagagggattttctgcattaaagctgaaa
gttgcacgtcggatagatcccattcaagatgctgcagctatacaagaagtaagaaaaaag
gttggcaggcagatcgaacttcgtgtggatgccaatagaaactggtcctacgaagaagct
atcagatttggctctctggtgaaagattgtgacctccagtacattgaggaacctgttcag
gatgaaaatgatattataaagtactgtgaagaaagtggcttacctgtggcacttgatgaa
actattgacaaaatttgtgaaaacccacttgatatgctcatgaagtatgctcaccctgga
atagttgctgtggtaatcaaaccaagtgttgtcggtgggtttgaaagagcagcattaatt
gcacagtgggcccatcggcagggaaagatggctgttgtcagtgctgcatttgaaagtggt
ctaagtttgttaacatatattcagttctcatattacctagagctgcagaatgcagatatt
tgcggagttatgaactataaattgaggccatctatagcccatggtctcggaacttatcaa
tggcttaaacaagacgtaacaactaaacctctggagatccgtcgtcatccacatagcggc
ttcatgggggcatctgttgctgataacattcaactcttgcagatgtttcaaatcaatcac
aatgttatttacagaacttctacaggggatcaagttcacagatacaatttagctgtgagt
tcaatggatttcacttgctccatcaaagtgcatgaggttggagaaaaaaacaatgataat
gttgttatatttcttcatggttttcttggaactggtgaagactggatctctatcatgaag
gccatctcaggatccgcaagatgcatttcaattgatcttcctggccatgggggatcaaag
attcaaaattgtggttgtgaagaagccaaagaggaagcaactttgtcagttgaaatggtt
gcacatatattatataagttgattccagacataactcctaaaaaggttgccattgttgga
tattcaatgggggcaaggatagctttgcggatggcactgagacattctgataaggtcagt
ggagctgttataatatctggtagccccggattgaaagatggacaggaaagaaaaattcgt
caggctagagatttttctaggtctcgcacactcatggattatgggctgcaactctttctt
gattcctggtacgctggggagctttggaacagcttgagaagccattcccgtttcaaggaa
atagttgccagccgcatgttgcatgatgatgtttacagccttgcaaaggttctgtctgac
ctcagtgttggtaggcaaatgccactgtgggaagaattgaagcaatgcaatatacccctt
ttactcatggttggggagaaagacaagaagttccaggcaattgccgaaaagatgtactct
gaaatttgtcaatttgaaaagggcaaagaagatgacatgggaattaatgttcctgagata
gttaagattcccaactgtgggcatgctgtgcatttggagaatcctcttcctgttatcggt
gaattgagacgattcctgaccaagctgagaaagttttccactctggagcacactgaaaac
atgcactaa

DBGET integrated database retrieval system