KEGG   Manihot esculenta (cassava): 110601087Help
Entry
110601087         CDS       T05761                                 

Definition
(RefSeq) probable 9-cis-epoxycarotenoid dioxygenase NCED5, chloroplastic
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
mesc  Manihot esculenta (cassava)
Pathway
mesc00906  Carotenoid biosynthesis
mesc01100  Metabolic pathways
mesc01110  Biosynthesis of secondary metabolites
Module
mesc_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    110601087
Enzymes [BR:mesc01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     110601087
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 110601087
NCBI-ProteinID: XP_021593788
Position
LG15
AA seq 603 aa AA seqDB search
MTSSTTTTASGNWARTQFPHLLSSSSLMDLGSISFTKSKPNSKKSKIHCALHSPSVLHFA
EQPYHAPVLPKDDSFLTVKQKTAHLLPPQLNLFQRAAAVALDMAEDALVANERQHQLPKT
ADPTVQISGNYAPVPEQPVRHALPVTGTIPECISGVYVRNGANPLFEPIAGHHLFDGDGM
VHAVKIDRGNASYACRFTETERLKQERELGRPVFPKAIGELHGHFGIARLLLFYARGLCG
LVDHTKGTGVANAGLVYFNDRLLAMSEDDVPYQVRVTASGDLETVGRYNFDGQLNHTMIA
HPKIDPVSKELFALSYDVVQKPYLKYFRFFPDGTKSPDVDIPLTVPTMMHDFAITENFVV
IPDQQVVFKLQEMIRGGSPVIYDKDKKSRFGILAKNARDAQDIIWVESPDTFCFHLWNAW
EEPESDEVVVIGSCMTPPDSIFNETDESLKSVLSEIRLNLKTGKSTRRPIIKESNQVNLE
AGMVNRNRLGRKTQYAYLAIVEPWPKVSGFAKVDLFTGEVKKFIYGDKKYGGEPFFLPRD
PNSEEEDDGYILAFVHDEKKWKSELQIVNARSLQLEATVKLPSRVPYGFHGTFIDSNDLS
NQA
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgacttcttctactactactactgcttccggtaattgggctagaacccaattccctcac
cttctttcttcttcttctctgatggatctgggctccatctcctttaccaagagcaagccc
aatagtaaaaaatccaaaattcactgcgctctacactctccctctgttcttcatttcgcc
gaacagccctatcatgcacccgtacttcccaaagatgactcctttctcactgtaaaacaa
aaaactgcccaccttctaccgcctcagttgaacctctttcaaagagcagcagctgtggct
ttagacatggcagaagatgcgttggtcgctaacgagcgccaacaccaactgcccaaaact
gctgatccaactgtccaaatctccggaaactatgctcccgtgcctgaacagcctgtccgg
catgcgcttccagtcaccggaactatccccgaatgcataagcggtgtgtatgtgcgtaac
ggtgctaacccactttttgagccgattgccggtcaccacttatttgacggagatggcatg
gtccacgctgtcaaaattgatagaggcaatgcgagctatgcttgtcgtttcactgaaaca
gaaaggctgaaacaagagagagaattgggcaggccagtgtttcctaaagcaattggcgag
ctacatggccactttggtatagcaagattacttcttttctatgccagaggattatgtggg
ctagtggatcacaccaaaggcactggagtagccaacgccgggcttgtctactttaatgac
aggcttcttgccatgtctgaggacgatgttccttaccaagtgcgcgtcactgccagtggc
gaccttgaaacagttggccgctacaatttcgatggccaacttaaccacacaatgattgcc
cacccaaagattgatccagtttccaaggagctatttgctctgagttacgacgtcgtccaa
aagccgtacctcaagtacttccgattcttccccgacgggacaaaatcaccggacgtcgat
atccctctcacagtgccaactatgatgcatgatttcgccatcactgagaatttcgtggtg
atacctgaccaacaagtcgttttcaagcttcaagaaatgataagaggtggctctccagtt
atttatgacaaggacaagaagtctcggtttgggattcttgcaaagaatgctcgtgatgct
caggatattatctgggtggaatcgccggatactttctgcttccatttatggaatgcatgg
gaggagccggaatccgatgaagtagtggtgatcggatcttgcatgactccaccggactcc
atcttcaacgaaaccgacgagagtttaaagagtgtattatcagaaatcagactaaattta
aagactggcaagtccacgcgccgccctataataaaagaatcaaaccaagtgaatttagag
gccgggatggtgaacaggaacaggttagggagaaagactcagtacgcttacctagccatt
gttgagccctggcctaaggtgtccggtttcgccaaggtggatctttttacaggggaggta
aagaaatttatatacggcgataaaaaatatggaggggagccatttttcctgccaagggac
cctaatagcgaagaagaggatgatggctacattcttgcttttgttcatgacgagaagaag
tggaaatcagagcttcaaattgtaaacgccaggagtttacagttggaagctacagttaag
ctaccatccagagttccctacggatttcatgggacattcattgactcgaacgacctgtcg
aatcaagcatag

DBGET integrated database retrieval system