KEGG   Manihot esculenta (cassava): 110601936Help
Entry
110601936         CDS       T05761                                 

Definition
(RefSeq) protein IWS1 homolog 1
  KO
K17498  transcription factor SPN1
Organism
mesc  Manihot esculenta (cassava)
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mesc03021]
    110601936
Transcription machinery [BR:mesc03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     110601936
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26 baeRF_family3
Motif
Other DBs
NCBI-GeneID: 110601936
NCBI-ProteinID: XP_021595041
Position
LG15
AA seq 519 aa AA seqDB search
MGYEDDPYRDEDGEPLMDYDEMQSDGGQSPEPHHDDFLEDDVDGWGEQARERSQTPVYDV
DKVGKPRKRLVKKSDSGMGTKENFVVPELVDEDEDGEFGRDYAMEAKKRKKLGKEGSGSI
GKDRKKFSKGEKKYSSNGGKGGSSSKSGLMKKGMYSGKLAGKEDGEVKEMWDTIAGGDSE
DDQDGPRTMDDDNFIDDSGLDPADRYGSDNEPRSPGDAPQAEEGEEDEEIKELFKMGKKR
KKNEKSPAEIALLVENVMAELEVTAEEDAELNRRGKPAINKLKKLPLLTEVLSKKQLQQE
FIDHGVLTLLKNWLEPLPDGSLPNINIRAAILKILTDFPIDLEQYDRREQLKKSGLGKVI
MFLSKSDEETTSNRKLAKDLVDKWSRPIFNKSTRFEDMRNIDDDRAYRRPTVRRPANSSA
GMESRDGDLDLDISRERRSGQSSARQQHASRPEATPLDFVVRPQSKIDPEEIRNRAKQVV
QDQRRLKMNRKLQQLKAPKKKQLQATKLSVEGRGMLKYL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgggttacgaagacgatccttaccgcgatgaggatggagagccgttgatggactatgac
gaaatgcaatcagacggtgggcaatctccagagcctcaccacgatgatttcctagaggat
gatgttgatggttggggtgagcaagcgcgagagaggtcacaaactccggtatatgatgtt
gataaggttggcaagcccagaaagaggttggtgaagaagagcgattcagggatgggtaca
aaggaaaattttgtcgtgcctgagttggttgatgaagatgaggatggggaatttggaagg
gattatgcaatggaagcaaaaaagaggaagaaacttggcaaggaaggatctggaagtatt
gggaaggataggaagaagtttagcaagggggagaagaagtattctagtaatggaggcaag
ggaggaagtagttcaaaatcagggttgatgaagaaggggatgtattcaggcaagttggct
gggaaggaagatggtgaggtcaaggagatgtgggatactattgctgggggtgattctgag
gatgatcaagacggtcctaggactatggatgatgacaacttcatagatgacagtggttta
gatcctgctgatcgatatgggagtgacaatgaaccacgctctcctggtgatgctcctcag
gcagaggagggtgaggaggatgaggaaatcaaggaactcttcaagatgggtaagaaaagg
aagaagaatgagaaaagtcctgcagaaattgcattgttagttgagaatgtcatggcagag
cttgaagttaccgctgaggaggatgcagaacttaatagaagagggaaacctgctatcaat
aaactcaagaagttgcctcttcttactgaggtcctatccaagaagcagctccagcaagaa
tttatagatcatggagtactaactctgctgaaaaattggcttgaacctcttccagatgga
agtttacccaatataaatatccgtgcagcgattttgaagattctgactgattttccaatt
gatctagaacagtatgatagacgagaacaattgaagaaaagtggtcttggaaaggttatt
atgttcttatcaaaatctgatgaagaaactacatccaacagaaaacttgcgaaggatttg
gttgataaatggagtcggcccatatttaataagagtacacggtttgaggacatgagaaat
attgatgatgatcgggcctaccgaaggccaacagtaagaaggccagcaaatagttctgca
gggatggaatctagggatggtgatctggatttggatatttcaagggagcgaagatctggt
caatcatctgccaggcagcagcatgcttctaggccagaagcaactccattggattttgtg
gtgcgtcctcagtctaagattgaccctgaagaaattagaaaccgtgccaaacaagttgta
caagatcagcgtcgactaaagatgaatagaaagttgcaacagctgaaagcaccaaaaaag
aagcaacttcaagctacgaagctgagcgtggaaggtcgtggtatgctcaaatacttgtga

DBGET integrated database retrieval system