KEGG   Manihot esculenta (cassava): 110603622Help
Entry
110603622         CDS       T05761                                 

Definition
(RefSeq) probable pyruvate, phosphate dikinase regulatory protein, chloroplastic
  KO
K20115  [pyruvate, phosphate dikinase]-phosphate phosphotransferase / [pyruvate, phosphate dikinase] kinase [EC:2.7.4.27 2.7.11.32]
Organism
mesc  Manihot esculenta (cassava)
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    110603622
Enzymes [BR:mesc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.27  [pyruvate, phosphate dikinase]-phosphate phosphotransferase
     110603622
   2.7.11  Protein-serine/threonine kinases
    2.7.11.32  [pyruvate, phosphate dikinase] kinase
     110603622
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinase-PPPase AAA_18
Motif
Other DBs
NCBI-GeneID: 110603622
NCBI-ProteinID: XP_021597110
Position
LG16
AA seq 409 aa AA seqDB search
MISFSTLRPPSPSLRPAPLPSSLARPQPNLKSLPLPTTQACSASDDKPQPRKLKGSSQLN
RWSRARAIRSGRKLDRSGQRTQVAELNSPPQQSRESELKESSTVTAGNRDDEGVDVTGGK
SIYMVSDGTGWTVEHSVGAALGQFEHCLVDRGCSVNTHLFSGIDDIDSLMEIIKQAAKEG
AMVVYTLADPSMAESARQACKLWGISSSDILGPITEAIASHLGVSPSGLPRGAPGRSLPL
SDEYFRRIEAIEFTIKQDDGALPKNLYKADIILAGVSRTGKTPLSIYLAQKGYKVANVPI
VMGVELPKSLFEVEPGKVFGLTINHVILQTIRKARARSLGFSQEVRSNYSEMDYVREELE
YARKIFAQNPVWPVIEVTGKAIEETAAVILRFYHDRKHKCSMPRISKRY
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgatttctttctcaaccttaaggccgccgagcccgagcctccgtccagcaccgctgccc
tcttcacttgcccgacctcagcccaatcttaaatcactccctttacccactactcaagcc
tgttctgcctcagacgacaagcctcagcctcggaagctgaagggaagctctcagcttaac
cggtggtccagggctcgagcaatccgctctggccgtaaattagaccgctcaggtcagcgg
actcaggtggccgagctcaattccccacctcaacaatccagagaaagcgaattgaaagaa
tctagtactgtaacagcgggcaatagagatgatgaaggcgtggatgtcacaggtgggaag
tccatttacatggtttccgacggcactggatggacagttgagcactccgttggcgcggcc
ttgggacagttcgagcattgcttggtcgatcgaggttgctctgtaaatactcatctgttt
tcagggattgatgatatagatagtttaatggagatcataaaacaagcggccaaagaaggt
gcaatggtagtttacactctggctgatccttccatggctgaatcagctagacaagcctgc
aagttatggggtatatcatcttctgacatattgggtccaataactgaggcgattgcttct
catcttggagtctcgccctctggtcttccccgtggagctccaggaaggagcttacccctt
tctgatgaatattttcgacggattgaagccattgaattcaccatcaagcaggatgatggt
gccctgcccaagaacttgtacaaggctgacattattcttgctggcgtttctcgtactgga
aagacaccattgtcaatttatttggcacaaaaaggatacaaagtggcaaatgtgcctatt
gtaatgggtgttgaattgccaaagagcctttttgaggttgagcctgggaaggtttttggt
ctgaccattaatcatgtgatcttacagaccattagaaaagcaagagctagaagtcttggg
ttcagccaggaagtgaggagtaactattcagagatggactatgttagagaggagttggaa
tatgctcgcaagatttttgcacaaaatcctgtctggccagtaatagaagtgacagggaag
gcgatagaagaaactgcagcagttatactaaggttttatcatgatcgtaaacacaaatgt
tcaatgccacggatctccaaacgttattag

DBGET integrated database retrieval system