KEGG   Manihot esculenta (cassava): 110603788Help
Entry
110603788         CDS       T05761                                 

Definition
(RefSeq) probable terpene synthase 3
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
mesc  Manihot esculenta (cassava)
Pathway
mesc00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    110603788
Enzymes [BR:mesc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     110603788
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth MA3
Motif
Other DBs
NCBI-GeneID: 110603788
NCBI-ProteinID: XP_021597397
Position
LG2
AA seq 548 aa AA seqDB search
MALQAATQRAQVRRTAQFHPTVWGDYFLKHVSDNEMQSVWTEGAKVLKEEVRRMLVTSVT
GYKPSEKLYLVDAIQRLGISYHFKREIEEALKQIFQDFEDEDVNLGIVALRFRLLRQQGY
NVSSDVFNKFKDGEGNFKEDLISDVQGLLSLYEASYLSVQGEDILDEALEFTKTHLTKAT
QFGSPLADQVSYALRWPTRRGLPKKESRDYFSIYQQDDAHVKPLLKLAKLDYNIVQTLHQ
RDMKIITKWWMDLDFTTKLPFARDRVIECSFWALGTFPEPEYVFARQVLSKAVAMLSVMD
DIYDVHGTIEELELFTKVVERWDISMKDQLPDYMKVYFEAFLDFYAEIEAVTTKEGRSFC
IHYAKEAVKKQVRAYITEARWFNSDYVPTLEEYISNGVISSTYPILITLSFCGMGEVASK
DTFDWLFTVPKLLYAASGLARLIDDIRSHEFEQERGHVASVVECYMKEHGVSQKQAYDEL
NKIITNLWKDLNEQLLKENAHLPKPVLMCILNIVRVMDVVYKDIDGYTNSDTSLKDILVT
FLVNPVAV
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggcccttcaagctgccacccaaagagctcaagttcgccgaacagcacagtttcatcca
acggtctggggcgactacttcctcaagcatgtatctgataatgagatgcaaagtgtttgg
actgaaggagccaaggttctgaaagaagaagttaggaggatgcttgttacctctgttact
ggttataaaccttcagaaaaactgtacctggtagatgctatacaacgacttgggatctct
taccattttaaacgagaaatagaagaagcactgaaacaaatttttcaagattttgaagat
gaagatgtaaacctcggtattgtcgctcttcgattccgccttctaagacaacaaggctat
aatgtttcatctgacgttttcaacaagttcaaggatggagaaggcaacttcaaggaagat
ttaatcagtgatgtgcagggcttgttgagcttgtatgaagcttcctatctcagcgttcaa
ggagaagatattctagatgaagctcttgaattcaccaaaactcacctaacaaaggcaacc
caatttggttcacctcttgctgaccaagttagctatgctttaaggtggcctacacgcaga
gggttaccaaagaaagagtcaagggattacttctctatttaccagcaagacgacgcacat
gttaaacctttactgaagcttgcaaagttggattataatatagtgcaaacattgcatcaa
agagacatgaaaattatcacaaagtggtggatggatttggacttcacaacaaaactacct
tttgctcgagacagagtgatcgaatgctctttttgggcattaggaacatttcctgagcca
gaatatgtttttgccagacaagtattgtccaaagctgtagctatgttgtctgttatggat
gatatctatgatgtgcatggtacaattgaagaacttgagctcttcaccaaagtagttgag
aggtgggatattagcatgaaagatcaacttcctgattacatgaaggtgtattttgaagca
tttttagatttctatgctgaaatagaggcagtgactacgaaggaaggaaggtcattctgc
attcactatgcaaaggaagcggtgaagaagcaagtgagagcctatatcactgaggcaaga
tggttcaacagtgactatgtgcccacactagaagaatatatttctaatggtgtgattagc
tctacttaccctatcttgataaccttatccttctgtggtatgggcgaagtggcttcaaaa
gacacttttgattggcttttcactgtgcctaaacttctatatgctgcatcaggtcttgcc
aggctaatagatgacatcaggtcccatgagtttgagcaagaaaggggacatgttgcctca
gttgtggaatgctatatgaaggaacatggtgtttcacagaagcaggcatatgatgagttg
aacaaaataataacaaatttgtggaaggatctcaacgagcagctccttaaagaaaatgca
catcttccaaagcctgttctgatgtgtattctgaatattgtaagggtcatggatgttgtc
tacaaggatatagatggttatacaaactccgacacttcacttaaggatatcctggttaca
ttcctagtcaacccagttgctgtttaa

DBGET integrated database retrieval system