KEGG   Manihot esculenta (cassava): 110605229Help
Entry
110605229         CDS       T05761                                 

Definition
(RefSeq) pyruvate decarboxylase 1
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
mesc  Manihot esculenta (cassava)
Pathway
mesc00010  Glycolysis / Gluconeogenesis
mesc01100  Metabolic pathways
mesc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110605229
Enzymes [BR:mesc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     110605229
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C DUF1995 CO_dh
Motif
Other DBs
NCBI-GeneID: 110605229
NCBI-ProteinID: XP_021599337
Position
LG17
AA seq 589 aa AA seqDB search
MEAANQLGSTAHPSSTPAPVPGIASTGTLGRHLARRLVEIGVNDVFSVPGDFNLTLLDHL
IAEPGLNNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVINAIAGAYSENLPVIC
IVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQAVTCVQVVVNNLDDAHEQIDTAISTAL
KESKPAYISISCNLPGIPHPTFTREPVPFLLSPNVSNQLGLEAAVEAAAEFLNKAVKPVI
VGGPKLRVAKAQKAFLELADATEYPLAVMPSGKGLVPEHHPHFIGTYWGAVSTSFCAEIV
ESADAYIFVGPIFNDYSSVGYSLLIRKEKAIMVQPNRVTIANGPSFGWVFMADFLSALAK
KLKKNSTAMENYKRIFVPPGIPLKCEKDEPLRVNILFKHIQQMLSGDTAVIAETGDSWFN
CQKLRLPENCGYEFQMQYGSIGWSVGATLGYAQAARNKRVIACIGDGSFQVTAQDISTMI
RSGQRSIIFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTAKVRTEDEL
TEAIARATGEQKDALCFIEVLVHKDDTSKELLEWGSRVSAANSRPPNPQ
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgctaatcaactcgggtcaactgctcatcctagctcgacacctgctcctgtc
cctggcatcgcctctacaggaactttggggcgccatttggctcggcgactggtggagatt
ggtgtcaacgatgttttctcagtccctggagacttcaacttgacacttttggatcatctg
attgcagagccagggttgaacaatatcggctgctgtaacgagcttaacgctggatatgct
gctgatgggtatgcacggtcaagaggcgtgggggcttgcgtggtgactttcactgtgggt
ggtctcagtgtgattaatgctattgctggtgcttatagtgagaatttgcctgtgatttgt
atcgtcggtggccccaattctaatgattatgggactaaccggattttgcatcacactatt
gggttgcctgattttagccaggagctcaggtgcttccaggcagtcacctgtgttcaagta
gtcgtgaataacttggatgatgcacatgagcaaattgacactgcaatttctactgctttg
aaggaaagcaagcccgcttatattagcataagttgtaatttgcccggaattcctcatcct
accttcactagggagccagtgccgtttcttctttctccaaatgtaagcaatcagttagga
ttagaggcagctgttgaagcagctgctgaatttctaaataaagctgtgaaacctgtcatt
gtggggggacctaaattaagggtggcaaaggcacagaaggcctttttagagctcgcagat
gccactgaatatccattagctgttatgccctcagggaaagggctagtaccagaacatcat
ccacatttcattgggacatactggggtgctgttagcactagcttttgcgcagagattgtg
gagtctgccgatgcctacatttttgttggccccatcttcaatgattacagctctgttgga
tattccttgctgatcaggaaggagaaagcaatcatggtgcagcctaatcgtgtgactatc
gccaatggcccttcctttggctgggtatttatggctgacttcttaagtgcattggccaag
aagttgaaaaagaacagcacagccatggaaaattacaaacgtatctttgtacctccaggc
atccctctgaagtgtgagaaagatgaacctcttagggtcaacatactcttcaagcacatt
cagcaaatgctaagtggagacactgcagtaattgctgaaactggagattcttggttcaac
tgtcaaaaactccgtctccctgagaattgtgggtatgaattccagatgcagtatgggtct
attggctggtctgttggtgcaactcttggatatgctcaggctgccagaaataagcgagtg
attgcttgcattggtgatgggagtttccaggtaacagctcaggatatttcaacaatgatc
cgttccggacagaggagtataatattccttatcaacaatggcggttacacaatcgaagta
gaaattcacgatggcccctacaatgtgatcaagaactggaattacaccggccttgtcgat
gccatccacaatggtgaaggcaaatgctggacagcaaaggttcgaacagaagatgaattg
acagaagcaattgcaagagcaacaggagaacaaaaggacgctctatgtttcattgaagtt
ttggtgcacaaggatgatactagcaaagagctgctggaatggggatccagagtttctgct
gctaacagccgtcctccaaatccacaataa

DBGET integrated database retrieval system