KEGG   Manihot esculenta (cassava): 110605948Help
Entry
110605948         CDS       T05761                                 

Definition
(RefSeq) serine/threonine-protein kinase-like protein At1g28390
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
mesc  Manihot esculenta (cassava)
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mesc01001]
    110605948
Enzymes [BR:mesc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110605948
Protein kinases [BR:mesc01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110605948
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr zf-RRPl_C4 PIP49_C APH
Motif
Other DBs
NCBI-GeneID: 110605948
NCBI-ProteinID: XP_021600331
Position
LG18
AA seq 492 aa AA seqDB search
MGYLSCNAESAIATCDPYYWECKRRKNKTNRNKPNKPIKIRDFTYPELVKATNGFSAESF
LGKGSHGTVYKASLDDGRLIAAVKAASRNPSISIHSNCTSCTTPAENEIEILSRVQHPRL
VNLIGFCVDCKDRKLLVVEYMPNGSLYSLLHCSSRPPGWTRRVRFALQIAKAVQALHSAN
PPVIHRDIKSPNVLIDENWNARLGDFGLALRGHVEDVRAKCTPPAGTLGYLDPGYLAPGD
LSTKSDVFSFGILLLEVISGRNAIDVNYSPPSIVDWAVPLIKRGDFSAICDHRIGSPVDP
GVIRNLAILAAKCVRSTAEKRPAMTEVVEALKMVRKRIQAPHIWNSLRRRVGLVEESRSN
EEAIDSNKEIVNANKTTRVGNRRNRKVSNVECGNETIGFAGERVSRSKSVGSFSDTKLRR
SDSRRKAGVAVKIPVVKLSKSRSMGVLQRSLDIEMEGVINSREIEASMSKLLIELDEKSE
QEMQEKPLVISI
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgggttatctctcttgcaatgcagaatctgcaattgccacctgcgatccctactactgg
gaatgcaagaggaggaaaaacaaaaccaacagaaacaaacccaataagcccattaagatc
agagattttacttacccggagctagtaaaagccaccaatgggttctccgctgaaagcttt
cttggcaaaggcagccacggcacagtttacaaagcttctctcgacgacggtaggcttata
gccgccgtgaaggcggcctctcgaaacccatcaataagcatccacagtaactgcacctct
tgcacaactcctgcagagaatgagattgagatactctctagagtacagcatccgaggcta
gtcaacctcattggtttttgtgtagattgtaaagacaggaaattactggttgtagaatac
atgccaaatggttcattatacagtcttctacactgcagctccagaccgcccggttggacc
aggcgtgtgcgattcgctttgcaaattgccaaggctgttcaagctttgcactcggccaac
ccgccggttattcacagagacataaaatcgccaaatgtgctgatcgacgagaactggaac
gcgaggcttggagatttcgggctcgccttgcgaggacacgtcgaagatgtacgagccaag
tgcacgccgccagcagggacattaggatacctcgaccctggctatctcgcgccgggagat
ttaagcaccaagagcgacgttttcagtttcgggatcttactgttggaagtgatcagtggc
agaaatgcaattgatgtcaactatagcccaccatctatcgtcgactgggctgtaccgttg
ataaagcggggggacttctccgctatttgcgatcacagaatcgggtcaccggtggacccg
ggagtgataagaaatctcgcaattctggcggccaagtgtgtgcgatccacggctgagaag
cgtcccgcaatgacagaggtagttgaagcgttgaaaatggttcgcaagagaattcaggcg
ccgcacatatggaacagtttgaggaggcgcgtgggactagtggaagaatcgcggtcaaat
gaggaggcaattgattcaaataaagagattgttaacgctaacaagacgactagagtgggg
aacagaagaaacaggaaagtatccaatgtagagtgcggaaatgaaacgattggatttgca
ggggagcgggtaagcagatcaaaatcggttggttcattcagcgataccaaactgcgaagg
tctgattcaagaagaaaagcaggtgtagcagtgaaaatcccggtagtgaagctgagcaag
tcaaggtcgatgggagtactgcaaagaagcttagacatagaaatggagggagtgataaat
tccagagaaattgaggcctccatgtctaagctgttgatagagttggacgaaaagtcagag
caagagatgcaagagaagccattggtgatctccatctaa

DBGET integrated database retrieval system