KEGG   Manihot esculenta (cassava): 110607486Help
Entry
110607486         CDS       T05761                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK10 isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
mesc  Manihot esculenta (cassava)
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mesc01001]
    110607486
   01009 Protein phosphatases and associated proteins [BR:mesc01009]
    110607486
Enzymes [BR:mesc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110607486
Protein kinases [BR:mesc01001]
 Serine/threonine kinases: Other
  Wnk family
   110607486
Protein phosphatases and associated proteins [BR:mesc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110607486
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C APH
Motif
Other DBs
NCBI-GeneID: 110607486
NCBI-ProteinID: XP_021602302
Position
Unknown
AA seq 573 aa AA seqDB search
MDFGSLEDDGEFAEKDPTGRYVRYDEILGRGAFKTVYKAFDEVDGIEVAWNQVSIEDVLQ
SADQLERLYSEVHLLKSLKHENIMKFYNSWVDDKKKTINMITELFTSGSLRQYRKKHKNV
DIKAIKSWARQILQGLQHMHNHSPPIIHRDLKCDNIFVNGNNGEVKIGDLGLATVMQQPT
ARSVIGTPEFMAPELYDEEYTELVDIYSFGMCILEMVTCEYPYSECKNPAQIYKKVITGI
KPASLGKVGDPQVKQFIEKCLVPVSMRLPATELLKDPFLATENSKDLVSVSLRIPELKSK
EVNSLQSESHSMDIDTNIKKPSIGSCTKSIGEVLPISTLEAHRFTGNNEFRLRGEKNYDS
TISLSLRIVEQCGRVKNIHFTFYLDTDTTVSIAEEMVEQLDLSNEDVGIIAELIDALIMK
LVPCWCPSGSTSSIPSGSDRLQNGATSDLLPLVKVVGQETPESFYSGISAELHMTIASDA
STNKPLGSFDYSVELNKTDLGSDFVMHVDSISKHDKSIKDSEDNLSELKLELNAIDMQYN
QCFKELSRMREEAIENAKKKWITKKEYTRHVMC
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggatttcggttcgcttgaggatgatggcgagtttgccgagaaagacccgactggtcga
tacgttcggtatgatgaaatattggggagaggtgcattcaagactgtatataaagcgttt
gatgaagttgatggaattgaagttgcctggaaccaagtgagtattgaagatgtgttgcag
tcggcagaccagctagaaagattatattcagaggttcatctgctgaagtcgctgaaacat
gaaaatatcatgaaattttataactcttgggtggatgataagaaaaagactatcaacatg
ataacagaattattcacctcaggcagtttgaggcagtaccgcaagaagcataagaatgtt
gatatcaaggccatcaaaagctgggcaagacagatccttcaaggtttacagcatatgcat
aatcacagtccccctatcattcatcgtgatttgaaatgcgacaatatatttgttaatgga
aacaatggggaagttaaaattggagatcttggactggcaactgttatgcaacaacctacg
gcacgaagtgttataggtactcctgaattcatggctccagagctctatgacgaggaatat
actgaacttgttgacatttattcttttggcatgtgcatattagaaatggttacctgtgaa
tacccatacagtgaatgcaagaacccagcacaaatatataagaaggttatcacgggcatt
aaacctgcttctcttggtaaagtgggtgacccccaggtcaagcagttcatagagaagtgt
ctagtcccagtatctatgagattgcctgcaacagaactcttgaaagacccattcctagct
actgaaaattctaaagatcttgtttctgtgtctttgaggataccagagcttaagtccaaa
gaagtcaactcactgcaatcagaatctcattccatggatatcgacactaacatcaagaaa
ccttcaataggctcttgtacaaaaagcatcggtgaggttctgccaatctcaaccttagaa
gcgcataggttcactgggaacaatgagttcaggttaagaggggagaaaaattatgatagt
acaatttcactgtctctgcgcattgttgaacaatgtgggagagtaaagaacatccatttt
actttctaccttgacactgatacaacagtttcaatagctgaagagatggttgaacagctt
gatttgtcaaatgaggatgtgggtatcattgccgagttgattgatgccttgataatgaag
cttgttccatgctggtgtccatctggaagtacatcaagtataccaagtggttctgataga
ctacagaatggtgcaacttctgatttattgcctttggttaaagtggttggtcaagagact
ccagaatcattttattcaggcatatctgctgaacttcatatgacaattgcctctgatgcc
agcactaacaagcctctgggatcttttgactactccgttgagttgaataaaactgatttg
ggttctgattttgtgatgcatgttgatagtatatctaaacatgacaaatccataaaagat
tctgaggataatctttctgagctaaagctggagctcaatgccattgatatgcagtataac
cagtgcttcaaagaactctcaaggatgagagaggaagcaatagaaaatgccaagaagaag
tggataacaaaaaaagaatatactcgacatgtaatgtgctag

DBGET integrated database retrieval system