KEGG   Manihot esculenta (cassava): 110609217Help
Entry
110609217         CDS       T05761                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP43-like isoform X1
  KO
K14826  FK506-binding nuclear protein [EC:5.2.1.8]
Organism
mesc  Manihot esculenta (cassava)
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mesc03009]
    110609217
Enzymes [BR:mesc01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     110609217
Ribosome biogenesis [BR:mesc03009]
 Eukaryotic Type
  Pre-60S particles
   Other pre-60S particles
    110609217
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NPL
Motif
Other DBs
NCBI-GeneID: 110609217
NCBI-ProteinID: XP_021604339
Position
LG2
AA seq 627 aa AA seqDB search
MAFWGAEVKAGKPFTHKPDDARGRLHISQATLGIGTGTKKSVVQCNVGKRSPVFLCSLFP
QQSESCQLNLEFEEADEVVFSVIGPISVHLTGYYVGGSRHYKQDESESYGEDIADTETER
STDGSGEDEYEDSFIDDGDQEVTPSSPVSNDGVAEEILHMRKPKNEKAKHRRLRKKYQLS
PSDDEYTSQQYTFANGATYIPALDSETDDVLAISSIYKSTERNRSPEAKENAEKVRGQKI
NEMKDDDNCAPVEEQKANAVVVDSEFRRQPDQHESNLPSAHVSSANDVKPKKKRKKQSKE
EKQLKTRNKDDFFFGAILKWDKDQQSETQADKLSQDMAVANEEDQRTSNEKGYVLPPPSV
ELAHGIASESKKKKKKQAKEEKGLQDGNPLHGNVNKDDKAKAENREKYILMKNEENQKKE
NDERISLPSIELVHVNAAKSRKKKKQQAKEGKVLEAGNPFCGNLNRDEANGENIEQDFLL
KNEEHQKKENDDRKDILPGNSQFPSNQLGTENGLKPKRKRKDKTLEASGKQTNVIKGDLP
IQEELKSNCIECNGSQQDEQNQRVFDNNVDQSANENDSRKRKKKRKNVILENRDALNMEE
AKDRAIVDTNGNNGNEKPSQLRSYQID
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggctttctggggagcggaagtgaaagccggaaagccattcacccataaacctgatgat
gcaagaggaagacttcacatctcacaggcaactttagggattggtaccgggacgaagaag
agtgtggttcagtgcaacgtagggaaaaggagccctgtttttctttgctctttgtttcct
cagcagtcggagtcatgtcaactaaatttggaattcgaggaggctgatgaggttgtgttc
tcagttattggccccataagtgttcatctcactggttactatgtgggtgggagtaggcac
tacaaacaggatgagtcagaatcatatggagaagatattgcagatacagagacagaacga
tctactgatggtagtggtgaggatgagtacgaagatagttttattgatgatggtgatcaa
gaggtgaccccatcttctcctgtttctaatgatggagtggctgaggagatattgcatatg
aggaaacctaagaatgagaaggccaagcatagacgacttaggaaaaagtaccagctgagt
ccgtctgatgatgagtacacttctcagcaatatacttttgccaatggtgctacttatata
ccagcattggacagtgaaactgatgacgtgttggcaatttcatccatctataaatctact
gaaaggaatagaagcccagaagcgaaagaaaatgctgagaaagtaagaggtcagaaaatt
aatgagatgaaagatgacgataattgtgccccagtggaagaacaaaaagcaaatgctgtt
gttgtagatagcgagttcagaaggcagcctgatcaacatgaatctaacttgccttccgct
catgtgagctccgcgaatgatgtgaagccaaagaagaaaaggaagaagcaatccaaagag
gagaaacaacttaaaactagaaataaagatgactttttctttggtgcaatccttaaatgg
gataaagaccaacaaagtgagacacaagctgacaaactaagtcaagatatggctgtagca
aatgaagaagaccagaggacttcaaatgagaaaggatatgtcttaccaccaccttccgtt
gaattggctcatggaattgcttcagaatccaagaaaaagaagaaaaaacaggcgaaggag
gaaaaaggtcttcaagatgggaatcctctccatggcaatgtgaataaagatgataaggct
aaggctgagaatagagagaaatatatcctgatgaaaaatgaagaaaatcagaagaaagaa
aatgatgagagaatctcattaccttccattgaattggttcatgtaaatgctgcaaagtcc
agaaagaaaaagaaacaacaggcaaaggaggggaaagttcttgaagcggggaatcctttc
tgtggcaatcttaacagagatgaggctaatggtgaaaacatagagcaagatttcttgtta
aaaaatgaagaacatcagaagaaagaaaatgatgacaggaaggatatcttgccagggaat
tcccaatttccctccaatcagttgggcactgaaaatggtttaaagccaaagagaaaaaga
aaagacaagacccttgaagcaagtggtaagcaaaccaatgtcatcaaaggggatctaccc
attcaagaagagttgaagtctaattgtatcgaatgcaatggatcccagcaagacgagcaa
aaccagagggtttttgacaataatgttgaccaatctgctaatgaaaatgactctcggaag
agaaagaagaagagaaagaacgtaattctggagaatagggacgcattgaatatggaagaa
gcaaaggacagagctattgtggacactaatggcaacaatggaaatgagaagccatctcag
cttaggtcctaccaaattgattag

DBGET integrated database retrieval system