KEGG   Manihot esculenta (cassava): 110612731Help
Entry
110612731         CDS       T05761                                 

Definition
(RefSeq) tyrosine-protein kinase JAK3-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
mesc  Manihot esculenta (cassava)
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mesc01001]
    110612731
Enzymes [BR:mesc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110612731
Protein kinases [BR:mesc01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110612731
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 110612731
NCBI-ProteinID: XP_021609195
Position
LG4
AA seq 977 aa AA seqDB search
MPASTEFPGGQVAEHTSAEDLLKKFSYRELADATDSFSENHSLGIGDFGDVYRGSLPSGE
VVAIKKLKCKQDGEQKEELENQIKDVGSVSHPNLVKLVGYCREKANRLLVLEFVPNKSLK
FHLSDEKKRSELKWSTRMEIALGSARGLAYLHEQCNPKIIHRDIKSDNILLDNNFKSKVA
DFGLAKIFPEINIRHIDKREDTIYTDPEISDDPEISDEKLDIYSFGVILLELISGRRIYE
SDLDIVNWAKPLMTKGDSINVNYKNLVDSTLKEDYDQIEMLSIIYCAAASLYSPSSKLRP
TMGQIVRTLEGKMPHKELWVVEGTQSASNDDYIAYELKTYTYSELAHATKSFTQGRQLGN
GGFGSVYWGFLLGKKVAIKKLNHQDSGQDQEEFEKEVNAVGIVRHGNLVKLVGYCNTNAD
RLLVLEFVTNKSLRYHLNDEQGRSNLKWSVRMKIAKGCAKGLAYLHEECNSKIIHRDIKA
ENILLDENYKPKIADFGLAKFFPITNSVTHISSHWKGTNVYADPENYNTQQGESIQQLSD
KSDVYSFGVVLLELISGRKINDEHQVDIVKWAKPLMIKGDSVEINYSSLVDSTLKGHYDE
KEMEIMIYCAAASVYRPAKLRPRMKQIVEALEGKMSPSELWAVQDVKFISRKPNELELQR
PSLLEKFDFDLLAEAAGHFSGERRLRRHGSCEVYEGELPGSDQRKVAIKKLDYMSFKQNK
EEFEKEIMAISNVNHRNIVNLIGYCSDEEDNRLLVFEFVANNSLKFHLHENGGSTIDWTR
RMEIAKGAARGLKYMHEDSGHKILHLYVKSDNILFDDKFIPKLAEFGSAKIFPDSLTHLS
ISKFKQNSGYMAPEYQSTIKLTDKLDIYSFGVILLELITGKQPFGHFSGPNDMVNWAKPL
LSQSLLEGKDKLDFVDEKLQEYNTEQMDRMIACVLACVDDDPQRRPRMSQILDVLEGNKS
LKETIKFLNLNQMKSGN
NT seq 2934 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgagtactgagttccccggaggacaagtcgcggagcacacatcagctgaggat
ttactcaagaaattttcatatcgagaactagcagacgcaactgattctttctccgaaaac
cattctcttggtattggtgattttggtgatgtctatagaggaagccttccaagtggtgag
gtcgttgctattaagaaactaaaatgtaagcaggatggtgagcagaaagaagaactcgag
aatcagattaaggacgtcggctctgtgtctcacccaaatcttgttaagctggtcggctac
tgccgtgaaaaagccaatagattgcttgttttagagtttgttcccaacaaatctttgaaa
tttcatctgagtgatgaaaagaaaagatcagagttgaagtggtcaacaagaatggaaatt
gctttaggctctgcgagaggtttagcatatctgcatgaacaatgtaatcctaaaatcatc
catcgagacattaaatccgataatatccttctcgataataactttaaatcgaaagttgct
gatttcgggcttgctaaaatttttccagaaattaatatcagacacatcgataaaagagaa
gataccatttacaccgatccagaaatttcagatgatccagagatttcagatgagaaattg
gatatttattcttttggagttatacttttagaacttataagtggaagaaggatttatgaa
agtgatcttgatatagtaaattgggcgaaacctctaatgacaaaaggagattcaataaat
gtgaactacaagaatttagttgattcaacattgaaagaagattacgatcaaatagaaatg
ctgtcaataatttattgtgcagctgctagcctatacagtccatcctcaaaacttcggcca
acaatgggacagatagttagaactcttgaaggaaaaatgccacataaggaattatgggtt
gtggaaggaacgcagtcagcttctaatgatgattatatcgcatatgaactgaagacatat
acatattcagaactagcacatgcaactaaatctttcacccaaggtcgacaactcggcaac
gggggctttggttctgtctattggggattccttctagggaaaaaagtagcaattaagaaa
cttaaccatcaggacagtggacaggaccaagaagaatttgaaaaggaggttaatgccgtt
ggcattgtgcgccatggaaatcttgttaagctggttggctactgcaatacaaatgctgac
agattgcttgttttagagtttgttaccaacaaatccttgagatatcatctaaatgatgaa
cagggaagatcaaatttgaaatggtcagtgagaatgaaaattgctaaaggttgtgcaaag
ggattagcatatctgcatgaagaatgtaattctaaaatcatccatcgtgatattaaagct
gaaaatatacttcttgatgaaaattataagccaaagattgcagattttggacttgcaaag
ttttttccaataactaatagtgtcactcacatcagctctcattggaagggaaccaacgtc
tatgcagatccagaaaattacaatactcaacaaggtgaatctattcaacaactttctgac
aaatcagacgtctattcttttggtgttgtgcttctggaacttatttctggaagaaaaatt
aacgatgaacatcaagttgatattgtgaagtgggcaaagcctttgatgatcaaaggagat
tcagtcgaaatcaattacagtagtcttgttgattccacattgaaaggacattacgacgaa
aaagaaatggaaataatgatttattgtgctgctgctagtgtatatcgacctgctaaactt
cgaccaagaatgaaacagatagttgaagctcttgaaggaaaaatgtctcccagtgaatta
tgggctgtgcaagatgttaagtttatatctcgaaagccaaatgaactggaactgcagcgt
ccttcgttgctggagaaatttgattttgatttgctagccgaggcagctggtcatttctca
ggagaacgacgccttcgacggcatggctcgtgtgaagtctatgagggagagctcccaggt
agtgatcaaagaaaggtggcaattaagaaacttgattacatgtcctttaaacagaataaa
gaggaattcgagaaggagattatggccattagcaacgttaatcatcgaaatattgttaat
ctaattggatactgcagtgatgaggaagacaatagactgcttgtttttgagtttgtagcc
aacaattccttgaaatttcatttacatgaaaatggaggatcaactatagactggacaagg
agaatggaaatcgccaaaggcgcggccagaggattgaaatatatgcatgaagacagtgga
cacaaaattttacatttgtatgtcaagtccgataacattctttttgatgataaatttata
ccaaagcttgcagaatttggaagtgccaagattttcccggattctcttactcatctctct
atcagcaaatttaagcaaaattccggatatatggctcctgagtatcaatctaccatcaag
ttgactgataagcttgacatttattcctttggtgtaattcttttggagttgattaccggg
aaacaaccatttggtcatttcagtggtcccaatgacatggttaattgggctaagccactg
ctctcacaaagtctgttggaaggaaaggacaagttggattttgttgatgagaaattacag
gagtacaacactgaacaaatggatcgaatgattgcttgtgttttagcttgcgtagatgat
gatccacaacgtaggccacgaatgagtcagatacttgatgttctggaagggaataaaagt
ttgaaagaaacaatcaagtttctaaatctgaatcagatgaaatccgggaattga

DBGET integrated database retrieval system