KEGG   Manihot esculenta (cassava): 110612736Help
Entry
110612736         CDS       T05761                                 

Definition
(RefSeq) proline-rich receptor-like protein kinase PERK15
Organism
mesc  Manihot esculenta (cassava)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase HYLS1_C
Motif
Other DBs
NCBI-GeneID: 110612736
NCBI-ProteinID: XP_021609207
Position
LG4
AA seq 148 aa AA seqDB search
MPASTEFPGGQVAEHTSAEDLLKKFSFEELAIATRHFSNKRVLGIGDFGDVYEGSLPSGE
LIAIKKLKYMQDGEQEEEIENQIKEVGSVSHPNLVKLIGYCCEEADRLLVLEFVPNKSLK
FHLSDEKKRSKLKWSIRMEIALGSLREV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgagtactgagttccccggaggacaagtcgcggagcacacatcagctgaggat
ttactcaagaaattttcatttgaagaactagcaattgcaactcgtcatttctccaacaaa
cgagttcttggcatcggtgattttggtgatgtctatgaaggaagccttccaagtggtgag
ctcattgctattaagaaacttaaatatatgcaggatggtgagcaggaagaagaaatcgag
aatcagattaaggaggtcggctctgtgtctcacccaaatcttgttaagctgatcggctac
tgctgcgaagaagccgatagactgcttgttttagagtttgttcccaacaaatctttgaaa
tttcatctgagtgatgaaaagaaaagatcaaagttgaagtggtcaataagaatggaaatt
gctttaggctctctgcgagaggtttag

DBGET integrated database retrieval system