KEGG   Manihot esculenta (cassava): 110612786Help
Entry
110612786         CDS       T05761                                 

Definition
(RefSeq) probable inactive receptor kinase At5g58300
Organism
mesc  Manihot esculenta (cassava)
Brite
Enzymes [BR:mesc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110612786
Protein kinases [BR:mesc01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110612786
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr LRRNT_2 LRR_4 PRIMA1 LRR_8
Motif
Other DBs
NCBI-GeneID: 110612786
NCBI-ProteinID: XP_021609317
Position
LG1
AA seq 608 aa AA seqDB search
MTLILYIFLAAALLLHVPFSTFVISINIDVFRTEERDALLQLRDSMTSSLDLHSNWTGPP
CIANFSRWVGVVCSDWHVIHLVLEGIQLSGPLPPAFLHNVSLLTKLSFRNNSVSGPLPNL
NNLVLLESVLLSYNRFTGSIPPEYIELPNLKELEFQQNYLEGQIPPFDQHNLTDFNVSYN
YFQGSIPRTETLRRFPESSYGHNLDLCGFPLEPCSAPSPAPAIISPPPPPPIRPRQDERK
KLEIWIVVLIAALAAFVPLLVVFVLVCCYKKVHGKETAKEPQSGVGPGGWTEKKLSHSQS
SKDPERRVELEFFDRNIPVFDLDDLLRASAEVLGKGKHGTTYKANLESGEVVAVKSLKNI
NGLIKKEFIQQMQLLGKLRHENLVQIISFYNSKEEKLVVYEFVPTGNLFELLHENRGIGR
VPLNWAARLTIIKDIAKGLEFLHRSLPSHKVPHANLKASNVLIHQDGQSYCAKLTNYGFL
PLLPSRKLSQRLAIGRSPEFSQGKKLTHKTDVYCFGIILLEVITGRIPGEGSPGNDEIVE
DLSDWVRTVVNNDWSTDILDVEILTTREGHDEMLKLIEMALQCTDVTPKTRPKMSEILRR
LEEIELRN
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgactcttattctgtacatatttcttgcagcagcactgcttctgcatgttccattttca
acctttgttatttccatcaacattgatgtttttcgcactgaagaacgagatgcattgttg
cagctaagggattctatgacttcctctttagacttgcattcaaattggactgggccacct
tgtattgcaaattttagcagatgggttggtgttgtttgttctgattggcatgtaattcat
cttgttcttgaaggaatccaactttcaggccctctccctcctgcattcctgcacaacgtt
tctttattgactaaactcagtttcagaaacaattcagtctctggaccgcttcctaatctc
aacaatcttgttctcttggaatctgtgctcctttcatacaacaggtttactggttcaatt
ccacctgagtacattgaattgccaaatctgaaagagctagagtttcagcagaattattta
gagggtcaaattccgccatttgatcaacacaacttgacagatttcaacgtttcttacaat
tatttccaaggttcaattcctcgaacagagactcttcgaaggttcccagagagctcctac
ggtcataacttggatctttgtggttttccattagagccgtgctcagctccatctcctgct
cctgccattatttcaccacctcctccccctccaataagaccaaggcaggacgagagaaag
aaactcgaaatttggatcgttgttttaattgctgcactggctgctttcgttccattgctg
gtagtgtttgttctcgtgtgttgttacaagaaggtgcacggaaaagaaacagcaaaagaa
ccacaatcaggggttggccctggaggatggacagagaagaaattgtcacattctcagagc
tcaaaggatccagaaagaagggtagagttggaattttttgacaggaatataccagtgttt
gatttggatgatttgctaagagcatctgcagaagtgttaggcaaggggaaacatggcact
acctacaaagcaaacttagaatctggtgaagttgttgccgttaagagtcttaaaaacata
aacggcttgatcaagaaagaatttatccagcaaatgcagcttctgggaaagctgaggcat
gaaaatctggtgcagattatttcattttacaactccaaagaggaaaagcttgttgtctat
gaatttgtacctactggcaatctgtttgagctattgcatgagaatagagggattggaaga
gttcctctgaattgggctgcgaggttgactataatcaaggatatagccaagggtctggaa
ttcctccaccgatccttgccttctcacaaggttcctcatgccaatctcaaagcatctaat
gtgttaatccatcaagatggccaaagctactgcgccaagctcacaaactatggcttcttg
ccgctgctaccttctcggaagttgtctcagaggctagccattggcaggtcgccggaattc
tctcaagggaagaaactcacacataaaactgatgtatattgctttggcattatcctgcta
gaggtcattactggtaggattccgggggagggttcacccggaaatgatgagatagtggag
gatctttccgactgggttcggacggtggttaacaatgattggtctactgatatattagat
gtagagatattgacaacaagagaaggccatgatgagatgttgaagcttatagagatggct
ctccagtgtacagatgtgacgccaaagacacggccaaaaatgagtgaaatattgagaagg
ttagaagagattgagctcagaaattga

DBGET integrated database retrieval system