KEGG   Manihot esculenta (cassava): 110615284Help
Entry
110615284         CDS       T05761                                 

Definition
(RefSeq) calmodulin-binding receptor-like cytoplasmic kinase 2 isoform X1
Organism
mesc  Manihot esculenta (cassava)
Brite
Enzymes [BR:mesc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110615284
Protein kinases [BR:mesc01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110615284
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH Kinase-like PIP49_C
Motif
Other DBs
NCBI-GeneID: 110615284
NCBI-ProteinID: XP_021612784
Position
LG1
AA seq 442 aa AA seqDB search
MMIAPHSVCGSRNAESDARSMQDFHYSPTSSCSEASTVRKRNPLAVAAKSVARSFVACFT
PPETTNYKNFDDSEEFKPPSANFYVISVASYATGSNRDRRRISGRGIYGSPQNSVHGREP
GSVKFTMEEIYKATRNFSPSFKIGQGGSGTVYKGRLEDGTVVAIKRAKKSAYDKHLGVEF
RSEVQTLAQVEHLSLVKFYGFFQNENERIVVVEYIPNGTLREHLDCLHGNVLQLAVRLDI
AIDVAHAVTYLHMYTDHPIIHRDIKSSNILLTENFRAKVADFGFARMAADTDSGATHIST
QVKGTAGYLDPEYLKTYQLTEKSDVYSFGVLLVELVTGRRPIEPKREIQERITARWAMEK
FAEGDAISTLDPRLERTDITDLLLEKILKLASQCLAPRRQNRPGMKKCAEILWGIRKDCK
ELSASDFRSLSSNSRSSSVRKE
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgatgatagctcctcactccgtctgcggctcccggaacgctgagtccgacgcaaggtca
atgcaagacttccattactcaccgacttcctcatgctctgaagcatccaccgtcaggaag
cggaacccgctggcggtggctgcaaaatcagtggccagatcgttcgtggcctgctttaca
ccgcctgaaaccaccaactataagaatttcgacgactccgaagagttcaaacctccctct
gccaatttctatgttatttcagttgcatcctatgcaacgggatccaacagagacagaagg
cgaatttcaggtcgaggtatctatggcagtccacagaattcagttcatggaagagaacca
gggagtgtaaagttcaccatggaggaaatctacaaagctacaaggaacttctccccgtcc
ttcaagattggacagggtggctctgggacagtatacaaggggagacttgaagatggaacc
gttgttgcaatcaaacgtgccaaaaagagtgcatacgataagcatttaggtgtagaattt
cggagtgaggttcaaacacttgcacaagtggagcacttgagtctagtaaagttctatggg
tttttccaaaatgaaaatgaaagaatcgttgtcgttgagtatattccaaatggaacgctc
agggaacacttggattgcctgcatggaaacgttcttcagcttgctgtgcgcctagatatt
gcaattgatgtggctcacgcagtcacctatcttcacatgtacacagatcacccgattatt
cacagggacataaagtcatccaacattcttctcacagaaaattttagagccaaggtggct
gattttggttttgcgagaatggcagccgacactgattcaggtgccacccacatctccact
caagttaaaggaactgctggctacttggatccagaatacctgaagacctatcaactgact
gagaagagtgatgtttattcatttggtgtgttacttgttgaactagtaactggtaggcgg
cctattgaaccaaaaagggaaattcaggagcggataactgcaagatgggctatggagaaa
ttcgctgagggagatgcaatttcaaccttggacccaaggctggaacgtactgatataacc
gacttgcttcttgagaagattcttaaattagcctcacaatgtttggccccacgcagacaa
aaccgaccaggcatgaagaaatgtgcggagattctatgggggattcgtaaggattgcaaa
gaactatcagcttcagattttcgttcactttcctcaaattcaaggagctcttcagttagg
aaagaataa

DBGET integrated database retrieval system