KEGG   Manihot esculenta (cassava): 110616119Help
Entry
110616119         CDS       T05761                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
mesc  Manihot esculenta (cassava)
Pathway
mesc00630  Glyoxylate and dicarboxylate metabolism
mesc00710  Carbon fixation in photosynthetic organisms
mesc01100  Metabolic pathways
mesc01110  Biosynthesis of secondary metabolites
mesc01200  Carbon metabolism
Module
mesc_M00165  Reductive pentose phosphate cycle (Calvin cycle)
mesc_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
mesc_M00532  Photorespiration
mesc_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    110616119
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    110616119
Enzymes [BR:mesc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     110616119
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 110616119
NCBI-ProteinID: XP_021614136
Position
LG5
AA seq 182 aa AA seqDB search
MASSMLSTATVASINRVSPAQATMVAPFTGLKSTPVFPTTRKTNSDITSITSNGGKVQCM
KVWPTLGMKKFETLSYLPPLTREQLASEVEYLLRSGWIPCLEFELEHGLVYREHARVPGY
YDGRYWTMWKLPMFGCTDAAQVLKELDELIKHHPDGYARIIGFDNVRQVQCISFLAYKPP
GA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctctatgctctcaactgctactgtggctagcattaacagggtcagccctgct
caggctactatggtggctccgttcaccggccttaagtccaccccagtcttccctaccacc
cgcaaaaccaactctgacatcacctccatcaccagcaacggtggcaaggtccaatgcatg
aaggtttggccaacacttgggatgaagaagttcgagactctctcataccttccaccactt
acaagggagcaattggccagcgaagttgaataccttcttcgttctggatggattccttgc
ttggaattcgagctagagcatggattggtgtaccgtgagcatgcaagagtaccagggtac
tacgatggtcgctactggaccatgtggaagctgcccatgtttgggtgcacagatgcagcc
caggtgttgaaggagcttgatgagctgatcaaacatcacccagatggctatgctaggatc
attggcttcgacaatgttcgccaagtgcagtgcatcagtttccttgcctacaagcctcct
ggcgcttaa

DBGET integrated database retrieval system