KEGG   Manihot esculenta (cassava): 110616476Help
Entry
110616476         CDS       T05761                                 

Definition
(RefSeq) putative kinase-like protein TMKL1
Organism
mesc  Manihot esculenta (cassava)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 110616476
NCBI-ProteinID: XP_021614533
Position
LG6
AA seq 358 aa AA seqDB search
MDSNSLLKLILGLTSATIFISLMVVIFLYFKNRARNDSIDVESPELKHGDEKEMEDLLTF
QGGQDLTISDILDAPGEVIGKSNYGTLYKALLHRSNCVRLLRFLRPVCIARAKDFEEAIQ
LLGSIRHPNLVPLVGFYAGPRGEKLLVHPFFRRGSMAQFIRDGNADSHKWTIIYRISLGI
AKGLDHLHTGLQKPVIHGNLKSKNILLDRNYQPYISDFGLHLLLNPTAGQEMLEASAADG
YKAPELIKMKDASELTDIYSLGIILLELLSGKEPISENPTPNDDFHLPNFMRNAVLDRRI
TDLYHPDILLSNHNDNEGPVTEECVLKFFQLAMACCSPSPSLRPTIRQVLWKLEEIGR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggatagcaacagtttgctgaaactcattcttgggctaacttcggctacgattttcatc
agtctcatggtcgtcatctttctttacttcaaaaacagggcaagaaatgactccattgac
gtagagagccctgaactcaagcatggggatgagaaagaaatggaggacttgttgacattt
caaggtgggcaagacctcacaatcagtgacattcttgatgctccaggagaggtgatagga
aaatccaactatggtaccttgtacaaggccttattgcacaggagcaactgtgtgaggctg
cttaggttcttgaggccagtttgcattgcaagggctaaagattttgaggaggcgatacag
ctgctgggcagcattagacatcctaatttagtccctcttgtggggttctatgcagggccg
agaggtgaaaagcttcttgttcaccccttcttcagacgtggcagtatggctcagttcatc
agagatgggaatgctgactctcacaaatggaccatcatttataggatatctcttggtata
gccaaaggattggatcatcttcacacaggattacagaagcctgtaattcatgggaatctc
aagtcaaaaaacatattgttggatcgcaattaccagccatacatatcagattttggcctg
caccttctcttgaatcctactgctggacaagaaatgcttgaagcttctgcagctgatgga
tacaaagctcctgagcttatcaaaatgaaagatgcaagtgagctgactgatatatacagc
cttgggataatcttgcttgaactactttcagggaaggagccaattagtgagaatccgacc
cctaacgatgattttcatctgccaaatttcatgagaaatgcagtccttgatcggagaatc
acagatttataccatccagatatacttcttagcaatcataatgataatgaaggacctgtt
actgaggaatgtgtgctcaagttctttcagcttgccatggcttgttgttctccttctcct
tctcttagaccaaccattaggcaagtactgtggaagcttgaagaaattggtagatag

DBGET integrated database retrieval system