KEGG   Manihot esculenta (cassava): 110616512Help
Entry
110616512         CDS       T05761                                 

Definition
(RefSeq) RNA pseudouridine synthase 2, chloroplastic isoform X1
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
mesc  Manihot esculenta (cassava)
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mesc03009]
    110616512
Enzymes [BR:mesc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     110616512
Ribosome biogenesis [BR:mesc03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    110616512
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-GeneID: 110616512
NCBI-ProteinID: XP_021614588
Position
LG6
AA seq 427 aa AA seqDB search
MLNLYAFSCISPSTKAFQSSTSLPFFPLNPRGFPSRVLLRIFTVHSSSNGSLNSCENQSQ
RINFAGMRLEETVEAKCGKLRLDSWISSRISGISRARIQSSIKSGLVAVNGRVVNKVSHN
VKGGDKVSCTISELQPLRAEPEDIPLEIVYEDEHLLVVNKPPHMVVHPAPGNPTGTLVNG
ILHHCSLPTVATSSQEVLSDVEDISDDEGLCSTLCGESVRPGIVHRLDKGTSGLLVVAKD
EHAHAHLSEQFKQHSIQRVYASLTSGVPSALRGRIEIPIGRDVNNRIRMSAIPGPIKQGQ
ARHAASRYKVIEILAGGGSALVEWRLETGRTHQIRAHAKYIGVPLLGDEVYGGTRSMALS
LLRPRIPPSCHNQLSLMLSGLERPCLHALALGFTHPHTGEEIHFSCPPPPDFAGILSQLR
KMGMEKV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgctcaacctctatgctttttcttgtatctctccatccacaaaagccttccaatcttca
acttctctacccttcttccctctaaatcctagaggatttccttccagggtacttttgagg
atctttacagttcattccagttccaatggaagcttgaattcatgtgaaaatcaaagccaa
agaattaatttcgctggtatgaggctagaggagactgtagaggccaagtgtggaaagttg
aggcttgattcttggatctcttctcgcatttctggcattagtagagctcgcatccaatca
agcattaaatctgggttggttgctgtcaatggcagggttgtcaataaggtgtctcacaat
gtcaagggtggggataaggtctcttgcacaatttcagagttgcaacccttgagggctgaa
cctgaggacatacctttggaaatagtttatgaagatgagcacttgctagttgttaataag
cctcctcacatggttgttcatccagcccctgggaaccctactggcacacttgtaaatggc
atacttcatcattgcagtcttccaacagttgcaacttcaagccaggaagttctttcagat
gtagaagatatttctgatgatgaagggttatgttctactttatgtggagaatcagttcgg
ccagggatagttcacaggttggacaaaggaactagtggattgcttgtagttgcaaaggat
gaacatgctcatgcccatttgtctgaacaattcaagcaacactctatccagagagtatat
gctagtcttactagtggtgtgccctctgcattgaggggacgtattgaaattcctattggt
cgtgatgtgaataacagaattcgtatgagtgctatacctggaccaattaagcagggacag
gctcgtcatgctgctagtaggtataaagtaattgaaatacttgctgggggtggttcagca
ttggtagagtggaggttagaaactggacgtactcatcagatccgtgcacatgcaaagtat
attggagttcctctattaggtgatgaggtttacggaggtaccagaagcatggctttatca
ctacttcgacccagaattcccccaagctgtcataatcaactttcactaatgctatcagga
ttagagaggccttgtctacatgctttggctcttgggttcacgcatccacacacaggggaa
gaaatacacttctcttgtccacctcctccagattttgctgggatcttgagccagcttcgt
aaaatgggcatggaaaaggtttaa

DBGET integrated database retrieval system