KEGG   Manihot esculenta (cassava): 110616540Help
Entry
110616540         CDS       T05761                                 

Definition
(RefSeq) probable inactive receptor kinase At2g26730
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
mesc  Manihot esculenta (cassava)
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mesc01001]
    110616540
Enzymes [BR:mesc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110616540
Protein kinases [BR:mesc01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110616540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 110616540
NCBI-ProteinID: XP_021614625
Position
LG6
AA seq 416 aa AA seqDB search
MSNFATIFLLFDVAGLLAVILLFILYFNKSRKLKKMLKKNNPEEGKGSGVVDDDDNDDDN
YLEEETKNMNRIELQSKEEAVREEKGGGLIFMEEEEAASFELDDLLKASAEGLGKGIFGN
SYKAMMEGRSAIVVKRLRDLKPLSYEEFRKQLSVISEMKHPNLLPLVAYYYSKEEKLLLY
KFAEKGNLFNRIHGGKGNKDRIPFRWGARLSVARGVARALEYLHLKNKSQTIVPHGNLKS
TNVLLDDNDMVLVSDYGMSSLLALPIAANRLASYKSPEYQASKRVYKKSDVWSYGGLILE
LLTGRVQAHTAPPGTKGVDLCSWVHRAVREEWTAEIFDIEISVQRSSTPGMLKLLQIAMR
CCDKSPENRPEMTEVVREVENIKLVESEDDEDLSLDQSLTDESLSTSASGIMGDER
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgtctaactttgcaaccatcttcttgctttttgacgttgctggtctacttgcagtgatt
ttgctcttcattctttacttcaacaagtcaagaaagctcaagaaaatgttgaaaaagaat
aacccagaagaaggaaaagggtcaggagtggttgacgacgacgacaacgacgacgacaac
tacttggaggaggagacaaagaatatgaacagaatagagttgcagagcaaggaagaagct
gtaagagaagagaaaggtggtggtctgatattcatggaagaagaagaagcagcaagcttt
gaacttgatgatcttctgaaagcttctgctgagggtttagggaaagggatatttggaaat
agttataaggcaatgatggaaggaagatcagccattgttgtgaaacgtttaagagatttg
aaaccattgagttatgaagaattcaggaagcagttgagtgtaatttctgagatgaagcat
ccaaatttgctgcctcttgttgcttattactattctaaggaggagaagttgcttttgtac
aaatttgctgaaaaaggaaacctcttcaatcgcattcatggaggaaaaggcaacaaggac
aggatcccatttcgttggggagcaagactatcagttgctcgaggagtggcacgagccctt
gaatatcttcatctgaaaaacaaatcacaaaccatagtcccacacggcaacctcaaatca
accaatgttctcctcgacgacaacgacatggttcttgtttcagactatggcatgtcttca
ctgctagcacttcccattgctgctaatcgcttggcttcttacaagtctccagaatatcag
gcatccaaaagggtatacaagaagtcagatgtctggagctatgggggtctcatattagaa
ctcttgacagggagagttcaggctcacacagctccaccaggaaccaaaggagttgatctt
tgcagttgggttcatagagctgtgagagaagagtggacagctgagatatttgatattgag
atatctgtgcagagaagttcaactcctggaatgctgaaactactgcagattgctatgcgt
tgctgtgataagtctcctgagaatcgtcctgaaatgacagaggtggtgagggaagttgaa
aatataaagcttgttgaatctgaagatgatgaagatttgtctttggatcagtctttaact
gatgaatctctttcaacaagtgcatcaggaataatgggtgatgaaagatga

DBGET integrated database retrieval system