KEGG   Manihot esculenta (cassava): 110616782Help
Entry
110616782         CDS       T05761                                 

Definition
(RefSeq) magnesium protoporphyrin IX methyltransferase, chloroplastic
  KO
K03428  magnesium-protoporphyrin O-methyltransferase [EC:2.1.1.11]
Organism
mesc  Manihot esculenta (cassava)
Pathway
mesc00860  Porphyrin and chlorophyll metabolism
mesc01100  Metabolic pathways
mesc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    110616782
Enzymes [BR:mesc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.11  magnesium protoporphyrin IX methyltransferase
     110616782
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mg-por_mtran_C Methyltransf_25 Methyltransf_12 Methyltransf_23 Methyltransf_11 Methyltransf_31 CMAS MTS Ubie_methyltran PrmA Methyltransf_32 Methyltransf_18 TehB
Motif
Other DBs
NCBI-GeneID: 110616782
NCBI-ProteinID: XP_021614966
Position
LG6
AA seq 321 aa AA seqDB search
MAYTSSLFAPTAFHTNKPRFSPVSTKPKTTRTVTVASIPPFSTASATDVSLFDGTTLAVI
GGGSVAALAAALSLTDPERRRRLQAEEVGGGDKEVVKEYFNNSGFQRWKKIYGETDDVNK
VQRDIRLGHSKTVENVLKMLKDEGSLEGVTVCDAGCGTGSLAIPLAKEGAIVSASDISAA
MVAEAEKQAKEQLQAVGENAAPMLPKFEVKDLESLDGKYDTVVCLDVLIHYPQSKADGMI
AHLASLAEKRLILSFAPKTFYYDLLKRVGELFPGPSKATRAYLHAEADVERALKKVGWRI
NKRGLITTQFYFARLVEAIPA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggcgtatacgtcgtccctattcgccccaactgccttccatactaacaaacctagattc
tctcctgtttctaccaagccaaagacgactagaaccgtaaccgtagcctccattcctccc
ttcagcaccgcctcggccaccgacgtttccttatttgatggcactaccctcgccgtcatt
ggcggaggctccgtcgctgcgttagccgccgctctctcccttacggacccagagcgccgg
cgccggctccaggctgaggaggtaggaggaggcgataaggaggtggtgaaagagtacttc
aacaattccggtttccagcggtggaagaagatttacggagagacggatgatgttaataag
gtacagcgcgacattaggctgggccattcgaagacggtggagaatgtattgaaaatgttg
aaagacgaagggtcactggaaggagtgactgtttgtgacgcaggttgtggtaccgggagt
ctagcgattccattggcaaaagaaggagcaattgtctcggcaagcgatatctctgctgct
atggtggccgaggctgagaagcaagcaaaagagcagctgcaagcagtcggcgaaaatgca
gcacctatgttgccgaaatttgaagtgaaggatctagagagcttagatgggaagtatgac
actgtagtatgcctagacgttttgatacattaccctcagagtaaagcagatgggatgatt
gcccatcttgcatcattggcagagaagcgactgattttgagttttgctccaaagacattt
tactatgatctattaaaaagagtgggggagttgtttcctgggccttcaaaggcaaccaga
gcatatctacatgcagaggcggatgtggagagagctttgaagaaggttgggtggaggata
aataagagaggcctgatcactacacaattttactttgcgaggcttgttgaagctattcct
gcataa

DBGET integrated database retrieval system