KEGG   Manihot esculenta (cassava): 110618918Help
Entry
110618918         CDS       T05761                                 

Definition
(RefSeq) proline-rich receptor-like protein kinase PERK13
Organism
mesc  Manihot esculenta (cassava)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase APH PIP49_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 110618918
NCBI-ProteinID: XP_021617882
Position
LG7
AA seq 607 aa AA seqDB search
MLDLCTLPERFGLREYSYGKLADSTDKFSNANLLGEGGFGQVYKGSIDGKVVAIKKLKQL
PDEQSREGLEQEIKVVSSVSHKNLVKLVGYCIEGPNRLLVLEYVPQRSLKFHLHGNNILE
WKNRMKIAIGSAKGLEYLHELCKPKIIHRDIKADNILVDDNFEPKVADFGLALFFPEIGS
LTHISRSNKGTEVYADPENYPSQKVSEKSDVYSYGVVLLELITGRKTKVEGIDIVTWAKA
RIEYALCSGDFTNLLDPKLQMNCVEEELRIMVCCATACVYKPSHFRPLMKEIVRALEGYM
SIKDIWDEKNDNKFLSDNPKPNGSHNVDEFQHTVPKPLVLSEAINGIEWRKFTQQELMVT
TNGSSNTTKVTKKFRAYFEDDYKLTRFTYQELTVATGGFSEDNRLDEGPLGQVYKGDLNG
EKVTVKKFNNPRKQEEEYKKMKAIGSSFHHRSLVNLIGYCEEGANRLLHGYMVTDGGSTL
HWSTRMRICFDAMFIEPLLLTSDKRWWDPSLHWKDIFLLGDDDLEPKLAEYGREKFFSDF
SPHKSNSCMAPEYTSTRMFTQKTSVYSCGVMLIEMITGKEAVDAVLQLVRSCCSINIVYK
YSCAFMK
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgctggatctgtgtaccttaccagaaagatttgggctaagagaatatagctatggtaaa
ctagcagattcaactgacaagttctccaatgcaaatctccttggtgagggtggttttggc
caagtttacaaaggatcaatagatggcaaagttgttgctattaagaaacttaaacaactt
ccagatgaacaatccagagaaggattggagcaagagatcaaggttgttagcagtgtgagt
cataaaaatcttgttaaactagtcggatactgtatcgaaggacccaatagattgcttgtt
ttggagtatgttccccaaagatcattaaaatttcatttacatggaaacaatattctagag
tggaagaatagaatgaaaattgctataggatcagctaaagggttggaatacctacatgaa
ctatgcaaacccaagattatacatcgtgatattaaggctgataatattcttgttgacgac
aattttgaacccaaggttgcagattttggtcttgccttgttttttccagaaataggtagc
ctcactcacatctctagatcaaataagggaactgaagtttatgcagatccagagaattat
ccctctcagaaagtatctgaaaagtcggatgtttattcctatggtgtagtgctattagag
ctaataacggggagaaaaactaaagttgaaggcatagatattgttacttgggcaaaagct
cgaattgaatatgctttatgcagtggagattttacaaatcttttagatcctaaattacaa
atgaattgcgttgaagaggaattaagaataatggtttgttgtgctacagcttgtgtatac
aaaccttcacactttcgcccactaatgaaagagatagttcgagctctcgaaggatatatg
agtataaaggatatatgggatgagaagaatgacaacaaattcttgagtgataaccctaag
cctaatggttctcataatgttgacgagttccagcatacggtaccaaagcctcttgtcctt
tcggaagctattaatggcattgagtggaggaaatttactcaacaggaactcatggttaca
actaatggctcctctaataccactaaagtcactaagaagtttcgagcttattttgaagac
gattataagctgactaggtttacttatcaagaacttacagtggcaactggaggtttctct
gaggacaaccgtcttgatgaaggtcctttgggtcaagtctacaagggagacctaaatggt
gaaaaggtgacagttaagaaatttaataatcctaggaagcaagaagaagaatacaagaag
atgaaagctattgggagtagtttccatcacagaagccttgttaaccttattggatactgc
gaagaaggagccaatagactgcttcatgggtacatggtaacagatggcggttcaactttg
cactggagtaccagaatgcggatctgctttgatgccatgtttattgagcctttgctgctc
acaagtgataagcgctggtgggatccatcacttcattggaaggacatctttcttcttggt
gatgatgatttagaaccaaagttagcagagtatggacgtgaaaagtttttttcagatttc
tcccctcataaatccaatagttgtatggctcctgaatatactagtactaggatgttcacc
cagaagaccagtgtttattcttgtggtgtaatgcttatagagatgataactgggaaagaa
gctgttgatgctgtacttcaattggtacgttcgtgttgctccattaatatagtctacaaa
tattcttgtgcatttatgaagtga

DBGET integrated database retrieval system