KEGG   Manihot esculenta (cassava): 110619469Help
Entry
110619469         CDS       T05761                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein 2-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mesc  Manihot esculenta (cassava)
Pathway
mesc03040  Spliceosome
mesc04141  Protein processing in endoplasmic reticulum
mesc04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110619469
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110619469
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110619469
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mesc01009]
    110619469
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mesc03041]
    110619469
   03009 Ribosome biogenesis [BR:mesc03009]
    110619469
   03110 Chaperones and folding catalysts [BR:mesc03110]
    110619469
   04131 Membrane trafficking [BR:mesc04131]
    110619469
   03051 Proteasome [BR:mesc03051]
    110619469
   03029 Mitochondrial biogenesis [BR:mesc03029]
    110619469
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mesc04147]
    110619469
Protein phosphatases and associated proteins [BR:mesc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     110619469
Spliceosome [BR:mesc03041]
 Complex B
  Other components
   Prp19 complex
    110619469
 Complex C
   Prp19-CDC5 complex
    110619469
Ribosome biogenesis [BR:mesc03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    110619469
Chaperones and folding catalysts [BR:mesc03110]
 Heat shock proteins
  HSP70 / DNAK
   110619469
Membrane trafficking [BR:mesc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    110619469
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    110619469
Proteasome [BR:mesc03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    110619469
Mitochondrial biogenesis [BR:mesc03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    110619469
Exosome [BR:mesc04147]
 Exosomal proteins
  Proteins found in most exosomes
   110619469
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A Radial_spoke_3
Motif
Other DBs
NCBI-GeneID: 110619469
NCBI-ProteinID: XP_021618635
Position
LG7
AA seq 648 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
QVAMNPVNTVFDAKRLIGRRFSDASVQGDMKHWPFKVIAGPGDKPMIVVTYKGEEKQFSA
EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
TAAAIAYGLDKKAGSAGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVQEFKRKHKKDISVNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY
TTITRARFEELNMDLFRKCMEPVEKCLRDAKIDKSSVHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKK
KVEAKNALENYAYNMRNTVKDEKISSKLAPDDKKKIEDAIEQAIQWLDTNQLAEADEFED
KMKELESICNPIIAKMYQGAGPDMGGGMDDDVPSAGGGGAGPKIEEVD
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggccggaaaaggagaaggtccagcgatcgggatagatctcgggacgacgtactcatgc
gtcggcgtttggcaacatgatagggtggagataatagccaatgatcaggggaataggacg
acgccatcttatgttgcttttactgatactgagcgtttgatcggcgatgctgctaagaac
caggttgccatgaatcccgtcaacaccgtctttgatgcaaagcgtttgattggtaggcga
ttcagtgatgcttctgtacagggtgatatgaaacactggccattcaaggttattgctggc
cctggtgacaagcctatgattgtggttacatacaagggtgaggagaaacaattttctgcc
gaagagatttcttctatggtgctcattaagatgcgtgagattgccgaagcttacctggga
acaacaataaagaatgcagtcgttactgtccctgcttatttcaatgactctcagcgccag
gcaactaaggatgctggagtgattgctggcctcaatgttatgcgaattatcaatgagccc
acagctgcagctattgcttatgggcttgataagaaggcaggaagtgctggggaaaagaat
gtgttgatctttgatttaggtggtggtacttttgatgtctcgttgcttaccattgaagag
ggtatctttgaagtaaaggccacagctggtgacactcaccttggaggtgaagacttcgat
aacagaatggtgaaccactttgttcaagagtttaaaaggaagcataagaaggatatctct
gtaaatcctagagcccttaggagattgagaacagcttgtgaaagggctaagagaactctc
tcatctactgctcagacaactattgagattgattctttgtacgagggtattgatttctac
acaactatcactcgtgccagatttgaggagcttaatatggatcttttcagaaagtgtatg
gagcctgttgagaagtgtttgagagatgctaagatagacaagagcagtgtacatgatgtt
gtccttgtcggtggctctactagaattcctaaggtgcagcaattgttgcaggacttcttc
aatgggaaggagctttgcaaaagcataaaccctgatgaggctgttgcttatggggctgct
gtgcaggctgcaatcttaagtggtgagggcaatgagaaggtgcaagatctgctgctcttg
gatgttacccctttgtctcttggactggaaactgctggaggtgttatgactgttctgata
ccaaggaacaccaccattcccaccaagaaagagcaggtgttctcaacctactccgataac
cagcctggggttttaatccaggtttacgagggtgagagaacaagaactagagacaacaat
ttgctcggaaaatttgagctatctggcattcctccagctccaagaggtgttcctcagatc
accgtttgctttgatattgatgctaatggtatcttaaatgtttctgccgaggataagacc
actggccagaagaacaagataacaattactaatgacaagggaaggttgtccaaggaagag
attgagaagatggtacaagaggccgagaagtacaaggccgaggatgaggaacataaaaag
aaggtagaggccaagaacgcattggagaactatgcctacaacatgaggaacacagtaaaa
gatgaaaaaatcagctccaaactggccccagatgacaaaaagaagatcgaggatgctatt
gaacaggctatccaatggttggatactaaccagcttgctgaggcagacgaatttgaggac
aagatgaaggagcttgagagcatctgcaatcctattatcgccaagatgtaccagggtgct
ggaccggacatgggtggcggcatggatgacgacgtcccatcagctggtggcggtggtgct
ggccctaaaattgaggaagttgactaa

DBGET integrated database retrieval system