KEGG   Manihot esculenta (cassava): 110619520Help
Entry
110619520         CDS       T05761                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
mesc  Manihot esculenta (cassava)
Pathway
mesc00010  Glycolysis / Gluconeogenesis
mesc00562  Inositol phosphate metabolism
mesc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110619520
   00562 Inositol phosphate metabolism
    110619520
Enzymes [BR:mesc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     110619520
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     110619520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 110619520
NCBI-ProteinID: XP_021618713
Position
LG7
AA seq 489 aa AA seqDB search
MKTFMASISFVIFWFSILLHSVAGQSFDVRQHLSTVTRYGVVKDEVNNSFEQFSIPEGCT
PIHLNLVARHGTRSPTKKKMKELAWLASHLEELIRDAKERNLPLQKVPTWLQGWKSPWKG
KSKGGELITKGEDELYDFGIRIRERFPNLFEEEYHPDVYLIKATQVPRASASAVAFGMGL
FSKKGTLGPWNQRAFAVSSESRASDIMLRFHDCCENYKAFRKSQEPVVEKLKKPILDAIT
AALVSRYELNFTRQDTASLWFLCKQEASLLDITDQACGLFNPSEVALLEWTDDLALFILK
GYGKSINYRMGVPLLEDVVQSMEQAIKVQEALIFLHSVRSEVLASGHYEKARLRFAHAET
LVPFTCLLGLFLEQSEFEKIQREQPLELPPRPPHSRNWWGSKVTPFAGNNMLVLHSCPAN
SSSKYFVEVLHNEYPIPMPGCNNSNFCPFEEFKEMVVAPHLKHNYNTLCAKKLEQPKQKI
ETIKGSSSF
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgttcatggcttccatctcttttgtcattttctggttttcaattctcttgcat
tctgttgccggtcaatccttcgatgtacggcagcacctctccactgtaacaagatatggt
gttgtgaaagatgaggtgaataattcctttgaacagtttagtattcccgaaggatgcact
cctatccacttaaaccttgtggcaagacatggaactcgttctcctaccaaaaagaagatg
aaagagttggcctggttggcatctcatttggaagaacttataagagatgccaaggaacgg
aacttacctttgcagaaagttcctacatggttacagggctggaaatctccatggaaaggc
aaatcgaaaggtggagaattgattaccaaaggagaagatgaattatatgattttggaatc
aggattagggaaagatttccaaatttgttcgaggaggaatatcaccctgatgtatatctg
ataaaggctacccaggttcctcgagcatcagctagtgctgtggcatttggcatggggctc
tttagtaagaagggaacccttggaccatggaatcaacgagcttttgcagtcagcagtgaa
agccgtgcaagtgatataatgcttaggtttcatgattgttgtgaaaactacaaggctttt
aggaaaagccaagagccagttgtcgaaaagcttaagaaacctattttagatgcaattact
gctgcattggtgagccgttatgagcttaattttacaagacaggacactgcttctctctgg
tttctctgtaaacaggaagcatccttgttggatataacagatcaagcgtgtggtctattc
aatccttctgaggtggctttgctggaatggacagatgacttggcattgtttatattgaag
ggttacggtaaatcaataaactacagaatgggagtgccattgcttgaagatgttgttcag
tccatggagcaagctattaaggtgcaagaagctttaatttttctccattctgttcgttca
gaagtacttgcctctggacattatgaaaaggcaagactacgatttgcacatgcagagact
ctggttccttttacatgtctgcttggtcttttccttgaacaatcggaatttgaaaaaata
cagagagagcaacctttggaacttcctccaaggcctccccacagtagaaattggtggggt
agcaaggtaacaccttttgctggcaacaacatgttggtcctgcacagttgtcctgcaaac
tcttcaagcaagtacttcgttgaagtactccacaatgagtatcccattccaatgccaggt
tgcaataattctaatttctgtccatttgaagagtttaaggaaatggtagttgctcctcat
ttaaagcacaactacaatacactctgtgctaagaagctggaacaaccaaagcagaagatt
gaaactataaagggcagctcttccttttag

DBGET integrated database retrieval system