KEGG   Manihot esculenta (cassava): 110621097Help
Entry
110621097         CDS       T05761                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
mesc  Manihot esculenta (cassava)
Pathway
mesc00260  Glycine, serine and threonine metabolism
mesc01100  Metabolic pathways
mesc01110  Biosynthesis of secondary metabolites
mesc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    110621097
Enzymes [BR:mesc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     110621097
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_3 Aminotran_5 Cys_Met_Meta_PP Glyco_hydro_101 RhaT
Motif
Other DBs
NCBI-GeneID: 110621097
NCBI-ProteinID: XP_021620846
Position
LG8
AA seq 358 aa AA seqDB search
MVTRMVDLRSDTVTKPTEAMRAAMANAEVDDDVLGYDPTASRLETEMAKIMGKEAALYVP
SGTMGNLISVLVHCDVRGSEVILGHNSHIHIYENGGISTLGGVHPRTVQNNKDGTMDIDL
IEASIRDPRGELVYPTTRLICLENSQANCGGRCLPVEYTDRVGELAKKHGLKLHIDGARI
FNAAVALGVPVHRLVEAADSVSVCLSKGLGAPVGSVIVGSKSFIAKARILRKTLGGGMRQ
IGILCAAALVAIQENAGKLEDDHQKAKTLAEGLNQIKGLRVDVAAVETNIIYLDIVEGSK
FTAENLCKNLEEHGVLVMQEGLLSVRIVLHHQISASDVQYTLSCFQQALTRAQDENGK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccagaatggtggatcttcggtccgacactgtaactaaaccaactgaagcaatg
agagcagctatggcaaatgctgaggttgatgatgatgttcttggttatgacccaactgcg
tcacgattagagactgaaatggccaaaatcatgggcaaggaagcagctctttatgttcca
tcaggcaccatgggtaaccttattagtgtactggtgcattgtgacgttaggggaagtgaa
gtaattcttggacacaattctcacatccacatatatgagaatggaggcatttcaactctt
ggaggtgtgcatcccaggacagtgcagaataacaaggatggaacaatggatattgattta
attgaagcttcaattagagatccaagaggggagcttgtttatccaactactaggcttatc
tgcttggagaattcacaagccaactgtggtggtagatgcctacctgtagaatatacagac
agagttggagaattagctaaaaagcacggtttgaagcttcacatcgatggggctcgcatt
ttcaatgcagcagttgcacttggagttcctgtgcataggcttgttgaagctgctgattca
gtttcggtatgcctatcaaaaggtttgggtgcaccagttggatcagttattgttggttca
aaaagctttattgcaaaggctagaatcctcaggaaaacattaggaggtgggatgcgacag
atcggtatcctttgtgctgctgctttggttgccatacaagagaacgctggaaagcttgag
gatgatcaccagaaagccaagactctagcagagggactgaatcaaatcaaaggactaagg
gtggatgtcgctgcagtagaaaccaacattatatatttggacatagtagagggctcaaaa
tttacggcagaaaatctatgcaagaacttagaagaacatggtgtgcttgtgatgcaagaa
ggcctactcagcgttaggatagttcttcaccaccaaatttcagcaagtgatgtgcagtac
actttatcatgcttccagcaagctttaacaagggctcaagatgaaaatggcaagtag

DBGET integrated database retrieval system