KEGG   Manihot esculenta (cassava): 110621907
Entry
110621907         CDS       T05761                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
mesc  Manihot esculenta (cassava)
Pathway
mesc00100  Steroid biosynthesis
mesc01100  Metabolic pathways
mesc01110  Biosynthesis of secondary metabolites
Module
mesc_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    110621907
Enzymes [BR:mesc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     110621907
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 110621907
NCBI-ProteinID: XP_021621895
Position
LG9
AA seq 230 aa
MGIDLKFFFVRAGMMGWLFINLSVLAKSIQDANLSCSMILYQLFCALYILDYFFYEEYMT
STWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLGNKVELTTAAVIANCLVFLIGYMVFR
GANKQKHVFKKNPKALIWGKPPRVIGGKLLASGYWGIARHCNYLGDLLLALSFSLPCGIS
SPVPYFYPIYLLILLIWRERRDEARCAEKYKEIWNEYRRLVPWRILPYFY
NT seq 693 nt   +upstreamnt  +downstreamnt
atgggcattgacctcaaattcttctttgttagagctggaatgatgggatggctatttata
aacctatcagttctagcaaaaagtattcaagatgccaacttgagctgttcaatgatcctc
taccaactattctgtgcgctatacatcctagattacttcttttatgaggaatacatgact
tccacatgggatataattgcagagagattgggcttcatgttggtgtttggtgatcttgtt
tggattcctttcacttttagcatccagggttggtggcttttgggtaacaaggtggagcta
acaacagctgctgttatagcaaattgcttagtttttctgattgggtacatggtctttaga
ggagctaacaagcaaaagcatgttttcaaaaagaatcccaaagcactcatatggggtaag
ccaccaagggttattggaggaaagctgctagcttctggttattgggggattgcaagacac
tgtaattatcttggagacttgttgttggctctgtcctttagtctaccttgtggaataagt
tctcctgttccgtacttttatccaatttatcttcttattctgctcatatggagagagaga
agagatgaggctcgctgtgcagagaagtataaagaaatatggaatgaataccgtagactt
gttccatggagaatactgccttacttctattaa

DBGET integrated database retrieval system