KEGG   Manihot esculenta (cassava): 110622417Help
Entry
110622417         CDS       T05761                                 

Definition
(RefSeq) probable L-type lectin-domain containing receptor kinase S.5
Organism
mesc  Manihot esculenta (cassava)
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_legB Pkinase Pkinase_Tyr Pkinase_fungal Kinase-like Bact_lectin APH SCF Ribosomal_L18_c
Motif
Other DBs
NCBI-GeneID: 110622417
NCBI-ProteinID: XP_021622602
Position
LG9
AA seq 648 aa AA seqDB search
MLFCVAAKFLAVAILLGFRLARVDCLNFNFTEFNPSSRDQLILSGNSNLFWGAIQVTPDA
DGAPKTNKSGRTIYGKPFRLWKKKGFNSSFNTTFVLNIQNQTYPGGEGVAFILTGSSDVD
INADGQWLGIVEPQMNNSAQAQTVGIEFDTRKSYEEDLDDNHVGLDINTVYSRVQFSLTN
LGVNLSSGTNISVRVRYDGELKNLTVFLEDMKIPVFSAIIDLSLYLPEKVYVGFSGSTSN
YTQLNCVRSWAFNSNDKDDKNLFWVWIVVPVLGLALLVGVAFSVYWKKKIDREKIEDSYP
SIEELIQGSSTAPRKFKLKHLRKATGNFSHKNKLGKGGFGTVYKGLMGDKLVAVKKVSKK
STQGKTEFIAEVTTIGKLHHRNLVKLIGWCYERREFILVYEYLPNGSLDRFIFCDDKSSM
EESTISWETRLSVVTGSAQALDYLHNGCEERILHRDIKSSNIMLDSEFNPKLGDFGLART
IKLSDQTHHSTKELAGTPGYMAPESILTGRFTIETDVYAFGILVLEVACGRKPGSQNHQD
DYSCNIVNWVWDLHRKGRIINAADPRLNGDFATEDMERVLILGLACCHPNPHKRPSMKIV
LQVLKGEATAPSVPSERPVFMWPPLPPSFKELDISLGQLAPFSELSAR
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgctcttctgtgttgctgccaagttcttagcagtagcaatccttcttgggtttcgtctt
gctcgagttgattgcttgaattttaactttacagaattcaacccatcatcaagagaccaa
ctcattctgagtggtaattcaaatttgttttggggagccatccaagttacaccagatgct
gatggagcccctaaaactaacaaatcaggccgcacaatctacggaaagccattcagactc
tggaagaagaaaggcttcaactcatcttttaataccaccttcgtgctcaatattcaaaat
cagacatacccaggaggagaaggcgtggcctttatattaacaggatcgtccgacgtcgac
attaacgccgacggacagtggcttggtatagtagagccgcagatgaacaattccgctcaa
gctcagacagtggggatagagtttgacactaggaaaagctacgaagaagatcttgatgac
aaccatgtcggcttggatataaacactgtctactctcgcgtacaattctcattaactaat
cttggtgttaatctttccagtggtacgaacattagcgtacgtgtccgatacgatggtgaa
ctaaaaaatctgaccgtcttcctcgaggacatgaagattccagtgttctctgcgatcatc
gatctctcactctatcttccagagaaagtttacgtgggattttcaggctcaacaagcaat
tacactcagctcaactgcgtgagatcatgggcgttcaacagtaatgataaagatgacaag
aatcttttctgggtttggattgtggttccagtcctaggattggccttgctggttggtgtc
gccttctctgtttactggaagaagaaaatagacagagagaaaatagaggattcttatccc
agcatagaagaattaatccaaggctcctccactgctccccggaagttcaaactgaaacat
cttcggaaagcaaccggcaacttcagccacaagaacaagcttggcaaaggcggctttgga
actgtctacaaagggctcatgggagacaagctggtcgctgtcaagaaagtttccaagaaa
tcaactcaaggcaagacagaattcatagcagaagtcaccacaattggcaagcttcatcac
agaaatctcgtcaagttaatcggatggtgctatgaaagacgcgaattcatccttgtttac
gagtacttgcctaatggaagcctagacagattcattttctgtgatgacaagtccagcatg
gaggaatctacgataagctgggagacaaggctcagcgtagtaactggctcagcacaggcg
ttggattatctgcacaacggctgcgaggagaggatacttcaccgagacatcaaatccagc
aacataatgttagattctgagttcaatcccaagctgggtgattttggacttgctcgtacc
attaaactcagtgatcaaactcatcactcgacgaaagaacttgcaggaacaccaggctat
atggctccagagagtattctcacaggaagatttacaattgaaacagatgtttatgccttc
gggatccttgtcctggaagttgcctgtggaaggaaacctgggagtcaaaatcatcaggat
gattatagctgcaacatcgtgaattgggtatgggacctccatagaaaaggaaggataatc
aacgccgcagatcccagattgaatggagactttgcaacagaagatatggagcgagtcctt
attctgggattggcatgttgccacccgaatccacacaagaggccgtcgatgaaaattgtt
ttgcaggttctgaaaggggaagcaacagcgccatcagtgcccagtgaaaggcctgttttt
atgtggcccccgttgcctccatctttcaaagagctcgatatctctcttggccaactcgct
ccattttcagaactcagtgcaagataa

DBGET integrated database retrieval system