KEGG   Manihot esculenta (cassava): 110622795Help
Entry
110622795         CDS       T05761                                 

Definition
(RefSeq) insulin-degrading enzyme-like 1, peroxisomal isoform X1
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
mesc  Manihot esculenta (cassava)
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mesc01002]
    110622795
Enzymes [BR:mesc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     110622795
Peptidases and inhibitors [BR:mesc01002]
 Metallo peptidases
  Family M16: pitrilysin family
   110622795
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C
Motif
Other DBs
NCBI-GeneID: 110622795
NCBI-ProteinID: XP_021623124
Position
LG9
AA seq 963 aa AA seqDB search
MAVEILKPRTDKRDYRRIVLKNSLQVLLISDPETDKCAASMNVSVGSFSDPVGLEGLAHF
LEHMLFYASEKYPLEDSYSKYITEHGGITNAFTSSEHTNYHFDVNADCFEDALDRFAQFF
IKPLMSPDATTREIKAVDSENQKNLLSDAWRMNQLQKHLSDEGHPYHKFSTGNWDTLEVR
PKAKGLDTRQELIKFYEENYSANLMHLVIYSKESLDKIQILAEDKFQEITNKDRSRFSFP
GQPCTSEHLQILVRAVPIKQGHKLNIIWPITPGILHYKEGPCRYLSHLIGHEGEGSLFYV
LKTLGWATGLTAGEGDWTTEFSFFKVVIDLTDVGHEHMQDIIGVLFKYIHLLQQSGVCKW
MFDELAAVCETMFHYQDKSSPIDYVVKTASNMEIYPPQDWLVGSSLPSNFNSSTIQMVLD
ELSPNNVRIFWESKKFEGKTEMVEPWYGTAYSIEKITTCAIQEWMLSAPVVNLHLPEPNV
FIPTDLSLKTAQEKQVKFPVLLRKSSLSSLWYKPDTMFSTPKAYVKIDFSCPHAGSSPDA
EVLTDMFTRLLMDYLNEYAYHAQIAGLYYGITNTDSGFQVTVVGYNHKLRILLEAVIEKI
AKFKVNPERFSVIKEMVIKEYENFKFQQPYQQAMYYCSLILQNQAWPWMDELEVLPHLEA
EDLAKFAPMMLSRSFLECYIAGNIESSEAESIIEHIEDVFYKGPNPICQPLFRSQHLSNR
VIKLEKGKSYFYPIKGLNPTDENSALVHYIQVHRDDFVPNVKLQLFALIAKQPAFHQLRS
VEQLGYITALMPRNDFGVQGVQFIIQSTVKGPARIDLRVEAFLKIFETKLYEMTNEEFQK
NANALIDMKLEKHKNLREESRFYWQEIYYGTLKFDRKDCEVAALRQLEQKEFVEFFNEYI
KVSAPQRRTLSVRVYGAPHLSEYASDKTESVSSNSVQIDDIFSFKRSQPLYGSFKGGFGY
MKL
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggagatattgaagccaagaacggacaagagagattacaggagaatcgttctc
aagaattcacttcaggtgcttcttatcagcgatcccgaaaccgataagtgtgctgcttcc
atgaatgtcagtgttggctcctttagcgaccctgtcggcctcgaaggccttgcccatttt
cttgagcatatgctattttatgctagtgaaaaatatccgttggaggatagttactccaag
tacattacagagcatggaggcatcaccaatgcttttacatcttctgagcacaccaactac
catttcgatgtcaacgctgattgttttgaagatgctttggacaggtttgcacagttcttt
attaaaccattaatgtcacccgatgcaacaacaagagagattaaggctgttgattctgag
aatcagaaaaatttattgtctgatgcttggagaatgaaccagcttcagaaacatctaagt
gatgaaggccacccatatcataaattcagtacagggaattgggatactcttgaagttcgg
cctaaagcaaaagggttggatacgagacaagagcttattaaattctacgaggaaaattat
tcagccaatctcatgcatctagtgatatattctaaggaaagccttgacaaaattcaaatc
cttgctgaggacaagttccaggaaataactaataaggatagaagccgtttttcttttcct
ggtcagccttgcacatcggagcatttacagatacttgtaagagctgtcccaataaaacaa
ggtcacaaattgaatatcatttggccaataactccaggaattcttcactacaaggaaggg
ccatgcaggtatcttagccatcttattggccatgagggagaaggatctttgttttatgtc
ttgaaaactttgggatgggctactggtttgactgcaggtgaaggggactggacaacagag
ttttctttttttaaagtagtaattgatctgactgatgttggtcatgagcacatgcaggat
attataggggtgctattcaaatacattcatctcttgcagcaatctggtgtttgcaaatgg
atgtttgatgagcttgctgctgtttgcgagacaatgtttcattatcaagacaaaagctct
ccgattgattatgtggtcaaaactgcatctaatatggagatatatcctcctcaagattgg
ttggttgggtcatcattgccttcgaatttcaattcaagcacaattcaaatggtattggat
gagctttctccaaataatgtccgaatcttttgggagtcgaagaaatttgaaggaaaaact
gaaatggtagagccatggtatggaactgcctacagtattgagaaaatcaccacctgcgca
attcaggaatggatgctgtctgctcctgttgtaaatctgcatttaccagaacctaatgtg
tttatccctactgatttatcactaaaaactgctcaagagaagcaggtcaaatttccagtt
cttttaagaaagtcatccttatcttctttgtggtacaagcccgacacaatgttctctaca
cccaaggcatatgttaagatagatttcagttgtccccatgctggcagctctcctgatgct
gaagttctaactgatatgttcactcgattgttaatggattatttgaatgaatatgcttat
catgcacagattgctggtctatattatggcattacaaacactgacagtggctttcaggtg
actgtggttggttataatcacaaactgaggatcttactggaagcagttattgaaaagatt
gcaaaatttaaagttaatcctgaaagattttctgtgatcaaggaaatggtgataaaggag
tatgaaaatttcaaatttcagcaaccatatcagcaggctatgtactattgctctttaatt
ctacagaatcaagcatggccgtggatggatgagcttgaagtgcttcctcatcttgaagca
gaagatcttgctaagtttgctccaatgatgctttctagatctttcttggaatgttatata
gcaggtaacattgaaagcagtgaggcagagtcaataattgagcatattgaagatgtcttt
tacaagggtccaaatcctatatgccaaccattattccgatcccagcatttgagcaataga
gttatcaagcttgaaaagggaaagagttacttttacccaattaaaggcttgaatcccact
gatgaaaattctgctttggtgcattacattcaggttcatcgagatgattttgtgccaaat
gtgaaacttcagctttttgctctaattgctaagcaaccagctttccaccagcttagatca
gttgagcaacttggatatatcactgcactaatgcccaggaatgattttggtgttcaaggt
gtacaatttattattcaatcgactgtaaagggtcctgcacgcattgatttgagagtcgag
gcattcctcaagatatttgaaactaaactttatgagatgacaaatgaagaattccagaaa
aatgctaatgctttgattgatatgaagcttgagaagcacaaaaatttgagggaagaatct
cgattttactggcaagaaatatattatgggaccttaaagtttgatagaaaagattgtgag
gtggctgcactaaggcaactggagcagaaagaatttgtggagttcttcaatgaatatata
aaagtcagtgcacctcagaggaggacattaagcgttcgtgtctacggggccccacattta
tcagagtatgcatcagataaaactgaatcagtttcatccaactctgttcaaatagatgat
attttcagcttcaaaagatcacaacctctttacggttctttcaaagggggcttcggctat
atgaagttgtag

DBGET integrated database retrieval system