KEGG   Manihot esculenta (cassava): 110628384Help
Entry
110628384         CDS       T05761                                 

Definition
(RefSeq) probable receptor-like protein kinase At5g18500
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
mesc  Manihot esculenta (cassava)
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mesc01001]
    110628384
Enzymes [BR:mesc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110628384
Protein kinases [BR:mesc01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110628384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 110628384
NCBI-ProteinID: XP_021630720
Position
LG12
AA seq 362 aa AA seqDB search
MCRFAVLITLTSNLIDDKKGIQAIYNCLGVQNLSSFLPGNGQAGNSEDGDTRQKTGSYDS
FSEDSNNLKISPKEIYLATNNLNEANFIGQGIAGKVYKGMLPNGQHVAVKHIINDGQMDT
FVREVTSLSHIRHPNLVALLGFCEHEDEYFLVYELCNNGNLSEWLYGKYRVLSWIQRLEI
AIDSAKGLWFLHTYPEGCIVHRDIKPTNILINAEFQAKLSDFGLSKVIDVGQSHVSSEVR
GTFGYVDPEYRQNHRVNAKGDVYSFGIVLLQLISGQRVINLNLSRPMQLNKMAKFLSRGG
NITEFADPKLNGEYSVEAFDLVLKLALSCTGMKLERPSMEKVVHILENALEISMKMKSIT
YD
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtgtagatttgcagttttgataacattaaccagcaatctgattgatgataagaaaggg
atccaggcaatttataattgccttggagtgcagaatctttcttcttttcttccaggaaac
ggacaagcaggcaattctgaagatggtgacaccaggcaaaaaacaggatcatatgattca
ttctctgaggattccaacaatctcaagatatcacccaaggaaatttatttagcaacaaac
aaccttaatgaagcaaacttcataggccaaggcatagccggaaaggtgtacaaggggatg
ctgcctaatgggcagcatgtcgcggttaagcacataatcaatgatggacaaatggataca
tttgtccgagaagttacaagcctgtcccatatcagacacccaaaccttgtagccttgctc
ggcttctgcgagcacgaagatgaatatttcctagtttatgagctctgcaacaatggtaac
ctatcagaatggctatatggcaagtatagagttctctcatggattcagagacttgagatt
gcaattgacagtgctaaggggctctggtttctccacacttatccagaaggctgcatcgtt
caccgcgatatcaagccaaccaacattctcataaatgctgaatttcaagcaaagctctca
gactttggattatcaaaagttattgatgtaggtcaatctcatgtgagctcagaagtgaga
ggcacatttggttatgttgatcctgaatatcggcaaaatcaccgtgtaaatgcaaagggt
gatgtctacagttttgggattgtgctgctgcagctaatctcagggcagagagtgatcaat
ctgaatttgagtagaccaatgcagctaaacaaaatggcaaaatttctctcaagaggtggt
aatataacagagtttgctgatccaaaacttaatggagagtactcagttgaagcttttgac
ctggttctcaagctggccttgtcatgtactgggatgaagctggaaaggccatcaatggag
aaagtggtacatatactagagaatgcacttgaaatttccatgaaaatgaagtcaatcact
tatgattaa

DBGET integrated database retrieval system